MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint puthalakath-1999-3 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis The source organism of bim sequences is not stated but assumed to be mouse as in previous experiments in the same paper. HeLa cell library Mol. Cell (1097-2765) 1999 puthalakath-1999-5 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. mouse-fdcp-1 Mus musculus bone marrow fdcp-1 long-term bone marrow culture of mice anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis The source organism of the Bim sequences is not stated but assumed to be mouse as in previous experiments in the same paper. HeLa cell library Mol. Cell (1097-2765) 1999 puthalakath-1999-1 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa cell library Mol. Cell (1097-2765) 1999 puthalakath-1999-6 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis The antibodies used in the westernblot do not allow identification of the interaction partner splice variants. HeLa cell library Mol. Cell (1097-2765) 1999 o54918-2 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH dlrb1_human Dynein light chain roadblock-type 1 DYNLRB1 BITH DNLC2A HSPC162 Dynein light chain 2A, cytoplasmic Dynein-associated protein Km23 Bithoraxoid-like protein DNCL2A ROBLD1 Roadblock domain-containing protein 1 protein protein human Homo sapiens Human MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE o54918-1 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK dlrb2_mouse Dynein light chain roadblock-type 2 Dynein light chain 2B, cytoplasmic Dynlrb2 Dnlc2b Dncl2b protein protein mouse Mus musculus Mouse MTEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH biml-dncl2a-2 coip of bim-l splicevariant and dynein 6426 N/A 6430 unspecified role unspecified role bait bait ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 6431 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false dncl2a-biml-1 coip of bim splicevariants and dynein 6426 N/A 6430 unspecified role unspecified role prey prey ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 6431 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false bimel-dncl2a-1 coip of bim splicevariants and dynein 6426 N/A 6431 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 6432 unspecified role unspecified role bait bait ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false bclxl-biml-1 coip of bcl-xl with bim and endogenous dynein 6426 N/A 6433 unspecified role unspecified role bait bait N/A 6430 unspecified role unspecified role prey prey ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 6431 unspecified role unspecified role prey prey association association false false false biml-dncl2a-3 coip of biml endogenous dynein and bcl2 6427 N/A 6434 unspecified role unspecified role prey prey N/A 6435 unspecified role unspecified role prey prey N/A 6430 unspecified role unspecified role bait bait ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O54918-2:p.Asp51Gly mutation mutation certain certain sequence position certain certain certain sequence position certain false O54918-2:p.Ser53Pro mutation mutation certain certain sequence position certain certain certain sequence position certain false O54918-2:p.Thr54Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false O54918-2:p.[Thr54Ala;Asn65Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false association association false false false Biml appear to be the bridging molecule as dynein can only be immunoprecipitade with Bcl-2 when Biml is expressed. When the biml mutants are expressed, cells die much faster after the induction of apopotosis (by irradiation or cytochine deprivation) compared to cells tranfected with wild type biml. bcl2-dncl2a-1 coip of bcl2 , endogenous dynein and Bim 6427 N/A 6435 unspecified role unspecified role prey prey N/A 6434 unspecified role unspecified role bait bait N/A 6430 unspecified role unspecified role prey prey ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Biml appear to be the bridging molecule as dynein can only be immunoprecipitade with Bcl-2 when Biml is expressed biml-dncl2a-1 2 hybrid screening of hela cell library with mouse bim splicevariants 6428 N/A 6430 unspecified role unspecified role bait bait region required binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O54918-2:p.Ser53Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false O54918-2:p.Thr54Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false O54918-2:p.[Thr54Ala;Asn65Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 6431 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false bim-dncl2a-1 coip of human engodenous bim and dynein 6429 N/A 6436 unspecified role unspecified role bait bait N/A 6431 unspecified role unspecified role prey prey physical association physical association false false false