IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pacchiana-2014-1 human-c4-i C4-I-Human Cervical squamous carcinoma cell line c4-i C4-I -Human Cervical squamous carcinoma cell line CRL-1594 http://www.lgcstandards-atcc.org/products/all/CRL-1594.aspx?geo_country=gb confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Pacchiana R., Abbate M., Armato U., Dal Prà I., Chiarini A. Affinomics - Interactions curated for the Affinomics consortium. anchiari@gmail.com Histochemistry and cell biology 2014 imex curation Only protein-protein interactions imex curation pacchiana-2014-2 human-c4-i C4-I-Human Cervical squamous carcinoma cell line c4-i C4-I -Human Cervical squamous carcinoma cell line CRL-1594 http://www.lgcstandards-atcc.org/products/all/CRL-1594.aspx?geo_country=gb pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Pacchiana R., Abbate M., Armato U., Dal Prà I., Chiarini A. Affinomics - Interactions curated for the Affinomics consortium. PLA and immunofluorescence combined: to visualize the nuclear envelope cells were incubated with an anti-Lamin B1 goat polyclonal antibody concomitantly with anti-Bcl10 and anti-PKC-zeta primary antibodies. Samples were incubated with an appropriate secondary antibody concurrently with the PLA probes. anchiari@gmail.com Histochemistry and cell biology 2014 imex curation Only protein-protein interactions imex curation pacchiana-2014-3 human-c4-i C4-I-Human Cervical squamous carcinoma cell line c4-i C4-I -Human Cervical squamous carcinoma cell line CRL-1594 http://www.lgcstandards-atcc.org/products/all/CRL-1594.aspx?geo_country=gb anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pacchiana R., Abbate M., Armato U., Dal Prà I., Chiarini A. Affinomics - Interactions curated for the Affinomics consortium. anchiari@gmail.com Histochemistry and cell biology 2014 Only protein-protein interactions imex curation imex curation bcl10_human B-cell lymphoma/leukemia 10 BCL10 CIPER CLAP Cellular homolog of vCARMEN Mammalian CARD-containing adapter molecule E10 Cellular-E10 CARD-like apoptotic protein B-cell CLL/lymphoma 10 CED-3/ICH-1 prodomain homologous E10-like regulator CARD-containing molecule enhancing NF-kappa-B protein protein human Homo sapiens Human MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ kpcz_human Protein kinase C zeta type PRKCZ PKC2 nPKC-zeta protein protein human Homo sapiens Human MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV 345trwe4r-1 1788146 N/A 1788149 unspecified role unspecified role neutral component neutral component N/A 1788150 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1,2 VP-16/Etoposide -a topoisomerase-II inhibitor bcl10-prkcz-1 1788147 N/A 1788149 unspecified role unspecified role neutral component neutral component N/A 1788150 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3/4 VP-16/Etoposide -a topoisomerase-II inhibitor An increased occurrence of PKC-zeta·Bcl10 complexes were seen both in whole nuclei (Fig. 5a) and at NEs (Fig. 5b) after VP-16 treatment. bcl10-prkcz-2 1788148 N/A 1788149 unspecified role unspecified role bait bait N/A 1788150 unspecified role unspecified role prey prey physical association physical association false false false 5C VP-16/Etoposide -a topoisomerase-II inhibitor