IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ vieira-2014-1 SNX31: a novel sorting nexin associated with the uroplakin-degrading multivesicular bodies in terminally differentiated urothelial cells. mouse-urothelium mouse urothelium or uroepithelium uroepithelium Uroepithelium_or_urothelium confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Vieira N., Deng F.M., Liang F.X., Liao Y., Chang J., Zhou G., Zheng W., Simon J.P., Ding M., Wu X.R., Romih R., Kreibich G., Sun T.T. Affinomics - Interactions curated for the Affinomics consortium. sunt01@nyumc.org PLoS ONE 2014 imex curation Only protein-protein interactions imex curation vieira-2014-4 SNX31: a novel sorting nexin associated with the uroplakin-degrading multivesicular bodies in terminally differentiated urothelial cells. mouse-urothelium mouse urothelium or uroepithelium uroepithelium Uroepithelium_or_urothelium pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Vieira N., Deng F.M., Liang F.X., Liao Y., Chang J., Zhou G., Zheng W., Simon J.P., Ding M., Wu X.R., Romih R., Kreibich G., Sun T.T. Affinomics - Interactions curated for the Affinomics consortium. sunt01@nyumc.org PLoS ONE 2014 imex curation Only protein-protein interactions imex curation vieira-2014-2 SNX31: a novel sorting nexin associated with the uroplakin-degrading multivesicular bodies in terminally differentiated urothelial cells. mouse-urothelium mouse urothelium or uroepithelium uroepithelium Uroepithelium_or_urothelium tem transmission electron microscopy tem immunocytochemistry immunocytochemistry Vieira N., Deng F.M., Liang F.X., Liao Y., Chang J., Zhou G., Zheng W., Simon J.P., Ding M., Wu X.R., Romih R., Kreibich G., Sun T.T. Affinomics - Interactions curated for the Affinomics consortium. Umbrella cells;flattened extendible cells forming the outermost layer. sunt01@nyumc.org PLoS ONE 2014 imex curation Only protein-protein interactions imex curation vieira-2014-3 SNX31: a novel sorting nexin associated with the uroplakin-degrading multivesicular bodies in terminally differentiated urothelial cells. mouse-urothelium mouse urothelium or uroepithelium uroepithelium Uroepithelium_or_urothelium anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Vieira N., Deng F.M., Liang F.X., Liao Y., Chang J., Zhou G., Zheng W., Simon J.P., Ding M., Wu X.R., Romih R., Kreibich G., Sun T.T. Affinomics - Interactions curated for the Affinomics consortium. sunt01@nyumc.org PLoS ONE 2014 Only protein-protein interactions imex curation imex curation vieira-2014-5 SNX31: a novel sorting nexin associated with the uroplakin-degrading multivesicular bodies in terminally differentiated urothelial cells. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay anti tag western anti tag western blot anti tag western Vieira N., Deng F.M., Liang F.X., Liao Y., Chang J., Zhou G., Zheng W., Simon J.P., Ding M., Wu X.R., Romih R., Kreibich G., Sun T.T. Affinomics - Interactions curated for the Affinomics consortium. Results for the positive control -PIP2 -Grip-(N-terminal GST-tagged recombinant PLC-delta1 PH domain) have not been included as the origin of the construct is not known. sunt01@nyumc.org PLoS ONE 2014 imex curation Only protein-protein interactions imex curation upk3a_mouse Uroplakin-3a Upk3a Upk3 Uroplakin III protein protein mouse Mus musculus Mouse MLLLWALLALGCLRCGWTVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGGMIVITSILGSLPFFLLVGFAGAIILSFVDMGSSDGEMTHDSQITQEAVPKTLGTSEPSYSSVNRGPPLDRAEVFSSKLQD mint Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence snx31_mouse Sorting nexin-31 Snx31 protein protein mouse Mus musculus Mouse MKMHFCIPVSQQRPDALGGRYVLYSVYLDGFLFCKVRYSQLHRWDEQLRRVFGNCLPPFPPKYYLAMTTAMAEERRDQLERYLQNVTADPRVTRSDVFTEFLTLVQLHTLNITIQNVELAVFLPDGRSIKVEGLTSDTAERVLEVMAHKLGLQPDLVGYFGLFLIQCFPEGKLSVVKKLADFELPYTSLQSSEMENCKIGLRKWYLDPALDSMLMDCRAAGDLLYMQAVQDIEKEWMKPTQAQREELKALQKKENQTKFLELSQEVRHYGYVQLDPCTCNHPEPGCGAQLSIGNNEISCCITLPNGQIQDIAFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYSEDSCQQWFVIYTKQAFFLSSCLKKMISERMTKLTEQSPEMQIEVPEQGRSKKHPSQPSQQKVYFNFLRKGKMKRSEGDYVWDTLMEEGL upk1b_mouse Uroplakin-1b Upk1b Uroplakin Ib protein protein mouse Mus musculus Mouse MAKDDSTVRCFQGLLIFGHVIVGMCGIALTAECIFFVSDQHSLYPLLEATNNDDIFGAAWIGMFVGICLFCLSVLAIVGIMKSNRKILLAYFIMMFIVYGFEVASCITAATQRDFFTTNLFLKQMLMRYQNNSPPTNDDEWKNNGVTKTWDRLMLQDHCCGVNGPSDWQKYTSAFRVENNDADYPWPRQCCVMDKLKEPLNLDACKLGVPGYYHSQGCYELISGPMDRHAWGVAWFGFAILCWTFWVLLGTMFYWSRIEY phosphatidylinositol-3-phosphate phosphatidylinositol 3-phosphate phosphatidylinositol 3-phosphates PI(3)P PtdIns3P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) snx31-upk3a-4 1778985 n/a 1778990 unspecified role unspecified role neutral component neutral component n/a 1778991 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1D, 6 D/F,9 Mice with the Buff -Vps33a D251E mutation show an augmented interaction. UPII-knockout snx31-upk3a-2 1778985 n/a 1778990 unspecified role unspecified role neutral component neutral component n/a 1778992 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6C/E positive control snx31-upk3a-5 1778986 n/a 1778990 unspecified role unspecified role neutral component neutral component n/a 1778992 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 6 G/I positive control snx31-upk3a-3 1778986 n/a 1778990 unspecified role unspecified role neutral component neutral component n/a 1778991 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 6 H/J Mice with the Buff -Vps33a D251E mutation show an augmented interaction. snx31-upk3a-1 1778987 n/a 1778990 unspecified role unspecified role neutral component neutral component n/a 1778991 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3G Co-localization is seen at the limiting membranes of multivesicular bodies snx31-mal-1 1778988 n/a 1778990 unspecified role unspecified role prey prey n/a 1778992 unspecified role unspecified role prey prey n/a 1778991 unspecified role unspecified role bait bait association association false false false 6A (B) phosphatidylinositol_trisphosphate-snx31-1 1778989 n/a 1778993 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1778991 unspecified role unspecified role prey prey c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 10