IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ adebiyi-2014-1 Lipid rafts are required for signal transduction by angiotensin II receptor type 1 in neonatal glomerular mesangial cells. pig-kidney-mesangial_cell Sus scrofa kidney-mesangial_cell kidney-mesangial_cell mesangial cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Adebiyi A., Soni H., John T.A., Yang F. Affinomics - Interactions curated for the Affinomics consortium. neonatal glomerular mesangial cells aadebiyi@uthsc.edu Exp. Cell Res. (0014-4827) 2014 Only protein-protein interactions imex curation adebiyi-2014-2 Lipid rafts are required for signal transduction by angiotensin II receptor type 1 in neonatal glomerular mesangial cells. pig-kidney-mesangial_cell Sus scrofa kidney-mesangial_cell kidney-mesangial_cell mesangial cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Adebiyi A., Soni H., John T.A., Yang F. Affinomics - Interactions curated for the Affinomics consortium. neonatal glomerular mesangial cells aadebiyi@uthsc.edu Exp. Cell Res. (0014-4827) 2014 Only protein-protein interactions imex curation cav1_pig Caveolin-1 CAV1 protein protein pig Sus scrofa (Pig) Pig MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRINMQKEI agtr1_pig Type-1 angiotensin II receptor AGTR1 Angiotensin II type-1 receptor protein protein pig Sus scrofa (Pig) Pig MILNSSTEDSIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVCAFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICLAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSENGSSSTKKSAPCTEVE agtr1-cav1 1766574 n/a 1766576 unspecified role unspecified role neutral component neutral component n/a 1766577 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6C agtr1-cav1-1 1766575 n/a 1766576 unspecified role unspecified role neutral component neutral component n/a 1766577 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 6D