IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ czeredys-2013-1 Caveolin-1--a novel interacting partner of organic cation/carnitine transporter (Octn2): effect of protein kinase C on this interaction in rat astrocytes. rat-astrocyte Rattus norvegicus astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Czeredys M., Samluk Ł., Michalec K., Tułodziecka K., Skowronek K., Nałęcz K.A. Affinomics - Interactions curated for the Affinomics consortium. lp.vog.ikcnen@zcelan.k k.nalecz@nencki.gov.pl PLoS ONE 2013 Only protein-protein interactions imex curation czeredys-2013-2 Caveolin-1--a novel interacting partner of organic cation/carnitine transporter (Octn2): effect of protein kinase C on this interaction in rat astrocytes. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Czeredys M., Samluk Ł., Michalec K., Tułodziecka K., Skowronek K., Nałęcz K.A. Affinomics - Interactions curated for the Affinomics consortium. lp.vog.ikcnen@zcelan.k k.nalecz@nencki.gov.pl PLoS ONE 2013 Only protein-protein interactions imex curation czeredys-2013-3 Caveolin-1--a novel interacting partner of organic cation/carnitine transporter (Octn2): effect of protein kinase C on this interaction in rat astrocytes. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. tem transmission electron microscopy tem antibody detection identification by antibody antibody detection Czeredys M., Samluk Ł., Michalec K., Tułodziecka K., Skowronek K., Nałęcz K.A. Affinomics - Interactions curated for the Affinomics consortium. lp.vog.ikcnen@zcelan.k k.nalecz@nencki.gov.pl PLoS ONE 2013 Only protein-protein interactions imex curation czeredys-2013-4 Caveolin-1--a novel interacting partner of organic cation/carnitine transporter (Octn2): effect of protein kinase C on this interaction in rat astrocytes. rat-astrocyte Rattus norvegicus astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Czeredys M., Samluk Ł., Michalec K., Tułodziecka K., Skowronek K., Nałęcz K.A. Affinomics - Interactions curated for the Affinomics consortium. lp.vog.ikcnen@zcelan.k k.nalecz@nencki.gov.pl PLoS ONE 2013 Only protein-protein interactions imex curation cav1_rat Caveolin-1 Cav1 Cav protein protein rat Rattus norvegicus (Rat) Rat MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQEEI flot1_rat Flotillin-1 Flot1 Reg2 Reggie-2 protein protein rat Rattus norvegicus (Rat) Rat MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAVGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQVNHNKPLRTA s22a5_rat Solute carrier family 22 member 5 Slc22a5 Octn2 CT1 High-affinity sodium-dependent carnitine cotransporter Organic cation/carnitine transporter 2 UST2r protein protein rat Rattus norvegicus (Rat) Rat MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFNGMSIVFLAGTPEHRCLVPHTVNLSSAWRNHSIPLETKDGRQVPQSCRRYRLATIANFSALGLEPGRDVDLEQLEQENCLDGWEYNKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQLFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFGFMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRVKEAEVIIRKAAKFNGIVAPSTIFDPSELQDLNSKKPQSHHIYDLVRTRNIRIITIMSIILWLTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQHLPRRYSISAALFLGGSVLLFIQLVPSELFYLSTALVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILTLFFPESFGAPLPDTIDQMLRVKGIKQWQIQSQTRTQKDGGESPTVLKSTAF cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI s22a5_human Solute carrier family 22 member 5 SLC22A5 OCTN2 High-affinity sodium-dependent carnitine cotransporter Organic cation/carnitine transporter 2 protein protein human Homo sapiens Human MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTIVTEWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYAFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFGLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFMQLVPPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKSTAF slc22a5-cav1 1572691 n/a 1572695 unspecified role unspecified role prey prey n/a 1572696 unspecified role unspecified role prey prey n/a 1572697 unspecified role unspecified role bait bait association association false false false 4A PMA- (phorbol 12-myristate 13-acetate) used here as a PKC activator. Flotillin-1 can be readily detected after PMA treatment, but this effect is reversed by Bisindolylmaleimide II (Bis II) -a protein kinase C (PKC) inhibitor- addition. slc22a5-cav1-1 1572692 n/a 1572697 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding_regions binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1572698 unspecified role unspecified role prey prey physical association physical association false false false 5D/E Both the 14-22 and 447-454 Octn2 fragments can bind caveolin-1; a simultaneous removal of both fragments leads to a further decrease of co-precipitating caveolin-1. However, the double deletion did not eliminate completely co-precipitation of mutated Octn2 with caveolin-1. slc22a5-slc22a5 1572693 n/a 1572697 unspecified role unspecified role neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1572699 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6 cav1-slc22a5 1572694 n/a 1572695 unspecified role unspecified role neutral component neutral component n/a 1572697 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7 Phorbol 12-myristate 13-acetate (CHEBI:37537)