IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ alpy-2013-1 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Fabien.Alpy@igbmc.fr J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation alpy-2013-4 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Cross-linking using 'Lomant's reagent'- (DSP- Dithiobis(succinimidyl propionate) Fabien.Alpy@igbmc.fr J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation alpy-2013-5 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. LAMP1 labeling was performed after PLA staining. Fabien.Alpy@igbmc.fr J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation alpy-2013-2 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Fabien.Alpy@igbmc.fr J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation alpy-2013-3 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. FRET-FLIM (Fluorescence-lifetime imaging microscopy) :- a shortening of donor lifetime is observed. Fabien.Alpy@igbmc.fr J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL q14849-1 StAR-related lipid transfer protein 3 STARD3 CAB1 MLN64 Metastatic lymph node gene 64 protein Protein CAB1 START domain-containing protein 3 protein protein human Homo sapiens Human MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA o95772-1 STARD3 N-terminal-like protein STARD3NL MENTHO MLN64 N-terminal domain homolog UNQ855/PRO1864 protein protein human Homo sapiens Human MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLEKEVMQYDYYSSYFDIFLLAVFRFKVLILAYAVCRLRHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL str3n_human STARD3 N-terminal-like protein STARD3NL MENTHO MLN64 N-terminal domain homolog UNQ855/PRO1864 protein protein human Homo sapiens Human MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLEKEVMQYDYYSSYFDIFLLAVFRFKVLILAYAVCRLRHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL vapb_human Vesicle-associated membrane protein-associated protein B/C VAPB UNQ484/PRO983 protein protein human Homo sapiens Human MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL star3_human StAR-related lipid transfer protein 3 STARD3 CAB1 MLN64 Metastatic lymph node gene 64 protein Protein CAB1 START domain-containing protein 3 protein protein human Homo sapiens Human MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA stard3-vapa 1567996 n/a 1568001 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1568002 unspecified role unspecified role neutral component neutral component ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 2 stard3-vapa-2 1567996 n/a 1568003 unspecified role unspecified role neutral component neutral component ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1568001 unspecified role unspecified role neutral component neutral component Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 2 stard3nl-vapa 1567996 n/a 1568004 unspecified role unspecified role neutral component neutral component n/a 1568001 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp Fig 2A stard3nl-vapa-1 1567996 n/a 1568003 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1568001 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp Fig 2B/C, 3 stard3-vapa-3 1567996 n/a 1568002 unspecified role unspecified role neutral component neutral component ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1568005 unspecified role unspecified role neutral component neutral component O95292:p.[Lys87Asp;Met89Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Supp Fig 2 D/F/H stard3nl-vapa-2 1567996 n/a 1568003 unspecified role unspecified role neutral component neutral component ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1568005 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O95292:p.[Lys87Asp;Met89Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Supp Fig 2 E/G/I stard3-vapa-6 1567997 n/a 1568001 unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1568003 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3G stard3-vapa-6 1567997 n/a 1568002 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1568001 unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3D/E stard3-vapa-6 1567997 n/a 1568002 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1568005 unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O95292:p.[Lys87Asp;Met89Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3F stard3-vapa-7 1567998 n/a 1568006 unspecified role unspecified role neutral component neutral component n/a 1568001 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7 B/G PLA dots colocalized with the endosome/lysosome marker LAMP1. stard3-vapa-8 1567998 n/a 1568004 unspecified role unspecified role neutral component neutral component n/a 1568001 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7 C/H, Supp Movie 7. PLA dots were typically excluded from the cell nucleus , and they colocalized with the endosome/lysosome marker LAMP1. stard3-vapa-1 1567999 n/a 1568001 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1568002 unspecified role unspecified role neutral component neutral component c_terminus mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Supplementary Material Movie 1+ 2 stard3-vapa-5 1568000 n/a 1568002 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c_terminus mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1568001 unspecified role unspecified role fluorescence donor fluorescence donor n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false proximity proximity close-contact colocalization neighbourhood interaction false false false 3B