IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ teranishi-2012-3 Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. human-brain-cortex Homo sapiens brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] pull down pull down western blot western blot Immuno blot Immuno blot Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation teranishi-2012-4 Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. rat-brain Rattus norvegicus brain brain Brain [cerebrum] pull down pull down western blot western blot Immuno blot Immuno blot Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation teranishi-2012-5 Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation teranishi-2012-6 Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. mouse-bd8 Mouse BD8 cell line - Blastocyst derived ES cells lacking PS1 +2 bd8 Mouse BD8 cell line - Blastocyst derived ES cells lacking PS1 +2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation teranishi-2012-7 Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. mouse-bd3 Mouse BD3 ES cell line- deficient in PS2 bd3 BD3 ES cell line- deficient in PS2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation teranishi-2012-8 Erlin-2 is associated with active gamma-secretase in brain and affects amyloid beta-peptide production. mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Teranishi Y., Hur J.Y., Gu G.J., Kihara T., Ishikawa T., Nishimura T., Winblad B., Behbahani H., Kamali-Moghaddam M., Frykman S., Tjernberg L.O. Affinomics - Interactions curated for the Affinomics consortium. Brain frontal cortex microsomal proteins were prepared. After removal of endogenous biotinylated proteins they were incubated either with GCB inhibitor or competing inhibitor L-685,458 (non specific binding control). The samples were incubated with Streptavidin-beads and the gamma-secretase complex captured. The Mass Spec. results shown in Figure 1A cannot be shown as it is not known if the experiment was carried out with Rat or Human brain; the authors did not respond to a request to supply the missing information.. Lars.Tjernberg@ki.se Biochem. Biophys. Res. Commun. (0006-291X) 2012 Only protein-protein interactions imex curation p49768-pro_0000025591 Presenilin-1 NTF subunit PSEN1 AD3 PS1 PSNL1 Protein S182 protein protein human Homo sapiens Human MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNM 1 298 nica_human Nicastrin NCSTN KIAA0253 UNQ1874/PRO4317 protein protein human Homo sapiens Human MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTFSINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY erln2_human Erlin-2 ERLIN2 C8orf2 SPFH2 Endoplasmic reticulum lipid raft-associated protein 2 Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2 UNQ2441/PRO5003/PRO9924 protein protein human Homo sapiens Human MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN gcb GCB small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) nica_rat Nicastrin Ncstn protein protein rat Rattus norvegicus (Rat) Rat MATARGGSGPDPGSRGLLLLSFSVVLAGLCGGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEDDLKWVLTDGPNPPYMVLLEGKLFTRDIMEKLKGETSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYDDFSFPIFLLEDENETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCMRRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSGGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMENGKFPVRLENIDSFVELGQVALRTSLELWMHTDPMSQKNESVKNQVEDLLVTLEQSGADTPQVVLSRLVQSQALPPSSLQRFLRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPESQSPEEDLNFVTDTAKALADVATVLARALYKLAGGTNFNNSIQADPQTVTRLLYGFLVRANNSWFQSILRHDLRSYLDDGPLQHYIAVSSPTNTTYVVQYALANLTGKVTNLTQEQCQDPSKVPNESKDLYEYSWVQGPWNSNKTERLPRCVRSTVRLARALSPAFELSQWSSTEYSTWAESRWKDIQARIFLIASKELEFITLIVGFSILVFSLIVTYCINAKADVLFVAPREPGAVSY p97887-pro_0000025599 Presenilin-1 NTF subunit Psen1 Psnl1 Protein S182 protein protein rat Rattus norvegicus (Rat) Rat MTEIPAPLSYFQNAQMSEDSHSSSVRSQNDNQERQQHHDRQRLDNPESISNGRPQSNFTRQVIEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIVSSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNM 1 298 erln2_rat Erlin-2 Erlin2 Spfh2 Endoplasmic reticulum lipid raft-associated protein 2 Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2 protein protein rat Rattus norvegicus (Rat) Rat MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTALKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGGLGKQSEGLSDKLGFGLEDEPLETATKDN p97887-pro_0000025600 Presenilin-1 CTF subunit Psen1 Psnl1 Protein S182 protein protein rat Rattus norvegicus (Rat) Rat AEGDPEAQRRVPKNPKYSTQGTEREETQDTGTGSDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSGSILTSEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLIFYFATDYLVQPFMDQLAFHQFYI 299 468 erln2_mouse Erlin-2 Erlin2 Spfh2 Endoplasmic reticulum lipid raft-associated protein 2 Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2 protein protein mouse Mus musculus Mouse MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTALKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDSAGGLGKQFEGLSDDKLGFGLEDEPLEAPTKEN psn1_mouse Presenilin-1 Protein S182 Psen1 Ad3h Psnl1 protein protein mouse Mus musculus Mouse MTEIPAPLSYFQNAQMSEDSHSSSAIRSQNDSQERQQQHDRQRLDNPEPISNGRPQSNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVIMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYVTVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVPKNPKYNTQRAERETQDSGSGNDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSGSILTSEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI gcb-erlin2-4 1427684 n/a 1427690 unspecified role unspecified role prey prey n/a 1427691 unspecified role unspecified role prey prey n/a 1427692 unspecified role unspecified role prey prey n/a 1427693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1B L-685,458 -a gamma secretase inhibitor The N-terminal domain of Presenilin-1 is identified by a combination of molecular weight and western blot. gcb-erlin2-5 1427685 n/a 1427694 unspecified role unspecified role prey prey n/a 1427695 unspecified role unspecified role prey prey n/a 1427696 unspecified role unspecified role prey prey n/a 1427693 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1B/C L-685,458 -a gamma secretase inhibitor The N-terminal domain of Presenilin-1 was identified by a combination of molecular weight and western blot. erlin2-gcb 1427686 n/a 1427696 unspecified role unspecified role bait bait n/a 1427697 unspecified role unspecified role prey prey n/a 1427694 unspecified role unspecified role prey prey association association false false false 1D/E There was a higher degree of interaction between erlin-2 and gamma-secretase in DRMs. erlin2-psen1 1427687 n/a 1427698 unspecified role unspecified role neutral component neutral component n/a 1427699 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 2A weak interaction - BD8 cells are deficient in PS1 and 2. erlin2-psen1-1 1427688 n/a 1427698 unspecified role unspecified role neutral component neutral component n/a 1427699 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 2C erlin2-gcb-1 1427689 n/a 1427698 unspecified role unspecified role neutral component neutral component n/a 1427693 unspecified role unspecified role neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 2 E-G