IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zieba-2012-2 Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Triple PLAs are shown in in Soderberg et al. 2006, Ref 10 - PMID:17072308. See figure 2f/g. The authors confirm that you would not expect a positive PLA signal if only two of the targeted proteins were present. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation zieba-2012-1 Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation zieba-2012-3 Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Normal mucosal epithelial cells of colon tissue obtained from healthy individuals. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation zieba-2012-4 Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Mucosal epithelial cells from colon tissue obtained from individuals with colorectal cancer (adenoma), and invasive adenocarcinoma. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation zieba-2012-5 Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation zieba-2012-6 Intercellular variation in signaling through the TGF-beta pathway and its relation to cell density and cell cycle phase. mouse-nmumg Mus musculus NMuMG mammary gland epithelial cells nmumg NMuMG mammary gland epithelial cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zieba A., Pardali K., Soderberg O., Lindbom L., Nystrom E., Moustakas A., Heldin C.H., Landegren U. Affinomics - Interactions curated for the Affinomics consortium. Ulf.Landegren@igp.uu.se. Ulf.Landegren@igp.uu.se Mol. Cell Proteomics (1535-9476) 2012 Only protein-protein interactions imex curation smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS smad4_human Mothers against decapentaplegic homolog 4 SMAD4 DPC4 MADH4 SMAD family member 4 Deletion target in pancreatic carcinoma 4 protein protein human Homo sapiens Human MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD smad2_human Mothers against decapentaplegic homolog 2 SMAD2 MADH2 MADR2 Mad-related protein 2 SMAD family member 2 JV18-1 protein protein human Homo sapiens Human MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS p12757-1 Ski-like protein Ski-related protein Ski-related oncogene SNO SKIL protein protein human Homo sapiens Human MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEAPVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARHSQESMSPTVFLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTLQQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQKTVSYPDVSLEEQEKMDLKTSRELCSRLDASISNNSTSKRKSESATCNLVRDINKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMRTYLKQQEKLNLILQKKQQLQMEVKMLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLAELRQRLDHAEADRQELQDELRQEREARQKLEMMIKELKLQILKSSKTAKE ski_human Ski oncogene SKI Proto-oncogene c-Ski protein protein human Homo sapiens Human MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAVPAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEAELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENEKKMKEANESRLRLKRELEQARQARVCDKGCEAGRLRAKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEKVVKELQEQLWPRARPEAAGSEGAAELEP smad2_mouse Mothers against decapentaplegic homolog 2 Smad2 Madh2 Madr2 Mad-related protein 2 SMAD family member 2 protein protein mouse Mus musculus Mouse MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS smad4_mouse Mothers against decapentaplegic homolog 4 Smad4 Dpc4 Madh4 Deletion target in pancreatic carcinoma 4 homolog SMAD family member 4 protein protein mouse Mus musculus Mouse MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIASGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS smad3-smad4-3 1428559 n/a 1428565 unspecified role unspecified role neutral component neutral component n/a 1428566 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1D, 2A, 2C, 2D, 2E, 3, Supp2A, 4B, Supp4 TGF-beta;the dose-dependent assembly of Smad3-Smad4 complexes reached a maximum at a concentration of 20 ng/ml TGF-beta. MG132 - proteasome inhibitor There was significant accumulation of Smad2-Smad4 and Smad3-Smad4 complexes in nuclei of stimulated cells 20 min after the addition of TGF-beta; this was sustained up to 45 min after the addition of TGF-beta, when the number of complexes attained a maximal value before decreasing again. Signals found in Interphase smad3-smad4-4 1428559 n/a 1428566 unspecified role unspecified role neutral component neutral component n/a 1428567 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1C, 2A, 2B, 4A, Supp 4, Supp1. TGF-beta;The highest accumulation of complexes between Smad2 and Smad4 was observed at a concentration of 20 ng/ml. There was significant accumulation of Smad2-Smad4 and Smad3-Smad4 complexes in nuclei of stimulated cells 20 min after the addition of TGF-beta; this was sustained up to 45 min after the addition of TGF-beta, when the number of complexes attained a maximal value before decreasing again. Signals found in Interphase skil-smad2 1428559 n/a 1428568 unspecified role unspecified role neutral component neutral component n/a 1428565 unspecified role unspecified role neutral component neutral component possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1428567 unspecified role unspecified role neutral component neutral component possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false Supp 3(D), 4D, Supp 4 Elevated numbers of these complexes were seen in mitotic cells and a lower level of complexes in cells in interphase. skil-smad2-1 1428559 n/a 1428567 unspecified role unspecified role neutral component neutral component possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1428569 unspecified role unspecified role neutral component neutral component n/a 1428565 unspecified role unspecified role neutral component neutral component possible_phospho_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false 3C, Supp 2C, 4C, Supp 4 MG132 -proteasome inhibitor Elevated numbers of these complexes were seen in mitotic cells and a lower level of complexes in cells in interphase. smad2-smad4-9 1428560 n/a 1428570 unspecified role unspecified role neutral component neutral component n/a 1428571 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1A TGF-beta smad2-smad4-10 1428560 n/a 1428571 unspecified role unspecified role neutral component neutral component n/a 1428572 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1A TGF-beta smad2-smad3-1 1428560 n/a 1428571 unspecified role unspecified role neutral component neutral component n/a 1428570 unspecified role unspecified role neutral component neutral component n/a 1428572 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1B TGF-beta smad2-smad4-11 1428561 n/a 1428567 unspecified role unspecified role neutral component neutral component n/a 1428566 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5A smad2-smad4-12 1428561 n/a 1428566 unspecified role unspecified role neutral component neutral component n/a 1428565 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5B smad2-smad4-13 1428562 n/a 1428567 unspecified role unspecified role neutral component neutral component n/a 1428566 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5C/E smad2-smad4-13 1428562 n/a 1428566 unspecified role unspecified role neutral component neutral component n/a 1428565 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5D/F smad2-smad4-14 1428563 n/a 1428567 unspecified role unspecified role neutral component neutral component n/a 1428566 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Supp 1 smad2-smad4-15 1428564 n/a 1428570 unspecified role unspecified role neutral component neutral component n/a 1428571 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Supp 1 TGF-beta