IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mistafa-2010-1 Purinergic receptor-mediated rapid depletion of nuclear phosphorylated Akt depends on pleckstrin homology domain leucine-rich repeat phosphatase, calcineurin, protein phosphatase 2A, and PTEN phosphatases. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mistafa O., Ghalali A., Kadekar S., Högberg J., Stenius U. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving the use of AKt1 and AKT1-Ser473 antibodies have not been included as these antibodies will all cross react with AKT2 and 3. Results using the antibody to Alpha-calcineurin are not included as the target of the antibody cannot be identified. aram.ghalali@ki.se J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation pcna_human Proliferating cell nuclear antigen PCNA Cyclin protein protein human Homo sapiens Human MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS cdn1a_human Cyclin-dependent kinase inhibitor 1 CDKN1A CAP20 CDKN1 CIP1 MDA6 PIC1 SDI1 WAF1 p21 CDK-interacting protein 1 Melanoma differentiation-associated protein 6 protein protein human Homo sapiens Human MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP cdkn1a-pcna-3 1532865 n/a 1532866 unspecified role unspecified role prey prey n/a 1532867 unspecified role unspecified role bait bait physical association physical association false false false 7C Insulin, ATP, Atorvastatin (a statin, inhibits HMG-CoA reductase) pcna-cdkn1a-2 1532865 n/a 1532867 unspecified role unspecified role prey prey n/a 1532866 unspecified role unspecified role bait bait physical association physical association false false false 7C Insulin, ATP, Atorvastatin (a statin, inhibits HMG-CoA reductase)