DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. PLoS biology 2008 imex curation Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. DIP original experiment: DIP-113505X PLoS biology 2008 IMEx S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. PLoS biology 2008 imex curation Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. DIP original experiment: DIP-113506X PLoS biology 2008 IMEx S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. PLoS biology 2008 imex curation Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. Only protein-protein interactions mouse Mus musculus Mouse molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. DIP original experiment: DIP-113508X PLoS biology 2008 IMEx S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. PLoS biology 2008 imex curation Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. DIP original experiment: DIP-113504X PLoS biology 2008 IMEx S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. S-nitrosylation of surfactant protein-D controls inflammatory function. PLoS biology 2008 imex curation Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. Only protein-protein interactions mouse Mus musculus Mouse comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Guo CJ., Atochina-Vasserman EN., Abramova E., Foley JP., Zaman A., Crouch E., Beers MF., Savani RC., Gow AJ. DIP original experiment: DIP-113507X PLoS biology 2008 IMEx S-nitrosylation of surfactant protein-D controls inflammatory function. sftpd_mouse Pulmonary surfactant-associated protein D Sftpd Sftp4 Lung surfactant protein D protein protein mouse Mus musculus Mouse MLPFLSMLVLLVQPLGNLGAEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF DIP protein P50404 original sequence version: 78 mint Contributes to the lung's defense against inhaled microorganisms. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties FE034261263F43E4 sftpd_rat Pulmonary surfactant-associated protein D CP4 Lung surfactant protein D Sftpd Sftp4 protein protein rat Rattus norvegicus (Rat) Rat MLHFLSMLVLLVQPLGDLGAEMKTLSQRSITNTCTLVLCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLPGPRGPVGPKGENGSAGEPGPKGERGLVGPPGSPGISGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGAKGPAGPKGERGAPGEQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGAPGDRGIKGESGLPDSAALRQQMEALNGKLQRLEAAFSRYKKAALFPDGQSVGDKIFRAANSEEPFEDAKEMCRQAGGQLASPRSATENAAVQQLVTAHSKAAFLSMTDVGTEGKFTYPTGEALVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF DIP protein P35248 original sequence version: 68 DB2BB5E399DB4A3C sftpd-1 4 7 unspecified role unspecified role unspecified role unspecified role P35248:p.[Cys34Ser;Cys39Ser] C34S/C39S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C34S/C39S'. Wed May 02 16:39:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser,cys39ser' Tue Jun 30 20:04:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys34Ser;Cys39Ser]' ecolx Escherichia coli covalent binding covalent binding sftpd-2 3 6 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association sftpd-3 1 7 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat physical association physical association sftpd-4 2 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction sftpd-5 5 6 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association