MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crif1 is a novel transcriptional coactivator of STAT3. Crif1 is a novel transcriptional coactivator of STAT3. EMBO J. (0261-4189) 2008 imex curation Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Crif1 is a novel transcriptional coactivator of STAT3. Crif1 is a novel transcriptional coactivator of STAT3. EMBO J. (0261-4189) 2008 imex curation Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Crif1 is a novel transcriptional coactivator of STAT3. Crif1 is a novel transcriptional coactivator of STAT3. EMBO J. (0261-4189) 2008 imex curation Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Crif1 is a novel transcriptional coactivator of STAT3. Crif1 is a novel transcriptional coactivator of STAT3. EMBO J. (0261-4189) 2008 imex curation Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Crif1 is a novel transcriptional coactivator of STAT3. Crif1 is a novel transcriptional coactivator of STAT3. EMBO J. (0261-4189) 2008 imex curation Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kwon MC., Koo BK., Moon JS., Kim YY., Park KC., Kim NS., Kwon MY., Kong MP., Yoon KJ., Im SK., Ghim J., Han YM., Jang SK., Shong M., Kong YY. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation g45ip_human Growth arrest and DNA damage-inducible proteins-interacting protein 1 39S ribosomal protein L59, mitochondrial MRPL59 CR6-interacting factor 1 CKII beta-associating protein Papillomavirus L2-interacting nuclear protein 1 p53-responsive gene 6 protein Mitochondrial large ribosomal subunit protein mL64 GADD45GIP1 PLINP1 PRG6 protein protein human Homo sapiens Human MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS 304C397AEC958804 stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM DIP protein P42227 original sequence version: 169 DIP protein P42227 original sequence version: 162 DIP protein P42227 original sequence version: 164 DIP protein P42227 original sequence version: 141 6C00626711C8012D stat3-gadd45gip1 1 STAT3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell CRIF1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association SF1A homomint mint gadd45gip1-stat3 5 CRIF1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined STAT3 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1A homomint mint gadd45gip1-stat3-1 5 CRIF1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6492549: original sequence: 1-320 : MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS [EBI-7770784]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 320-320, sequence length 222 [EBI-7770784]1-320 ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined STAT3 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1D homomint mint gadd45gip1-stat3-2 4 STAT3 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CRIF1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B homomint mint gadd45gip1-stat3-3 3 STAT3 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CRIF1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B Treatment with OSM increases the interaction. homomint mint gadd45gip1-stat3-4 2 CRIF1 6 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined STAT3 8 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F2A Proteins colocalize after treatment with OSM. homomint mint