IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SCL binds the human homologue of DRG in vivo. SCL binds the human homologue of DRG in vivo. Biochim. Biophys. Acta (0006-3002) 1998 Zhao XF., Aplan PD. Cancer - Interactions investigated in the context of cancer paplan@sc3101.med.buffalo.edu 25-Jun-2008: Contacted by JYOTI. Human fetal brain (Stratagene), human fetal liver and human thymus cDNA libraries (Clontech) were used. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhao XF., Aplan PD. Cancer - Interactions investigated in the context of cancer paplan@sc3101.med.buffalo.edu Accepted 2008-JUN-12 by DAVET. 25-Jun-2008: Contacted by JYOTI. Human fetal brain (Stratagene), human fetal liver and human thymus cDNA libraries (Clontech) were used. Biochim. Biophys. Acta (0006-3002) 1998 davet SCL binds the human homologue of DRG in vivo. SCL binds the human homologue of DRG in vivo. Biochim. Biophys. Acta (0006-3002) 1998 Zhao XF., Aplan PD. Cancer - Interactions investigated in the context of cancer paplan@sc3101.med.buffalo.edu 25-Jun-2008: Contacted by JYOTI. Human fetal brain (Stratagene), human fetal liver and human thymus cDNA libraries (Clontech) were used. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhao XF., Aplan PD. Cancer - Interactions investigated in the context of cancer paplan@sc3101.med.buffalo.edu Accepted 2008-JUN-12 by DAVET. Human fetal brain (Stratagene), human fetal liver and human thymus cDNA libraries (Clontech) were used. Biochim. Biophys. Acta (0006-3002) 1998 davet tfe2_human Transcription factor E2-alpha Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Immunoglobulin transcription factor 1 Transcription factor ITF-1 Kappa-E2-binding factor TCF3 E2A ITF1 BHLHB21 Class B basic helix-loop-helix protein 21 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM DIP protein P15923 original sequence version: 171 DIP protein P15923 original sequence version: 132 DIP protein P15923 original sequence version: 126 52F5E3DE1890AE13 tal1_human T-cell acute lymphocytic leukemia protein 1 TAL1 SCL TCL5 Stem cell protein T-cell leukemia/lymphoma protein 5 BHLHA17 Class A basic helix-loop-helix protein 17 protein protein human Homo sapiens Human MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGPGGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR DIP protein P17542 original sequence version: 159 DIP protein P17542 original sequence version: 107 33BBE31589DBB7C7 drg1_human Developmentally-regulated GTP-binding protein 1 Neural precursor cell expressed developmentally down-regulated protein 3 DRG1 NEDD3 Translation factor GTPase DRG1 protein protein human Homo sapiens Human MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK 4A177EA7C8E23005 htf4_human Transcription factor 12 Transcription factor HTF-4 E-box-binding protein DNA-binding protein HTF4 TCF12 HEB HTF4 BHLHB20 Class B basic helix-loop-helix protein 20 protein protein human Homo sapiens Human MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQAKKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWSSSNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNPSTPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSLVASSRSASMVGTHREDSVSLNGNHSVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSETTNPMGHM DIP protein Q99081 original sequence version: 135 DIP protein Q99081 original sequence version: 56 DIP protein Q99081 original sequence version: 91 DIP protein Q99081 original sequence version: 85 9736113D9361D3F5 itf2_human Transcription factor 4 Immunoglobulin transcription factor 2 SL3-3 enhancer factor 2 ITF2 SEF2 TCF4 BHLHB19 Class B basic helix-loop-helix protein 19 protein protein human Homo sapiens Human MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRNYGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAEREKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM DIP protein P15884 original sequence version: 159 DIP protein P15884 original sequence version: 93 DIP protein P15884 original sequence version: 116 53459FC7989D9487 tal1-drg1 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association The DRG clones were isolated from the human fetal liver and human thymus cDNA libraries. PREY gene AF078103 During a search for SCL binding partners using the yeast 2-hybrid system, we isolated two independent cDNA clones (clone L51 and clone V3) of the human DRG homologue from human fetal liver and human thymus cDNA libraries. tal1-tcf3 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Most of the clones encoded the E-proteins ITF-1, ITF-2, or HEB, which are bHLH proteins known to interact with SCL. tal1-tcf4 2 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Most of the clones encoded the E-proteins ITF-1, ITF-2, or HEB, which are bHLH proteins known to interact with SCL. tal1-tcf12 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Most of the clones encoded the E-proteins ITF-1, ITF-2, or HEB, which are bHLH proteins known to interact with SCL. tal1-drg1-1 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association PREY gene AF078103 The specific interaction between human SCL and DRG was displayed by the expression of the HIS3 and lacZ genes driven by a functionally reconstituted GAL4 in yeast cells 1 tal1-tcf4-1 1 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 1 growth on the SCL/ITF-2 sextant serves as a positive control