IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Requirement for CDK4 kinase function in breast cancer. Requirement for CDK4 kinase function in breast cancer. Cancer Cell (1535-6108) 2006 imex curation Yu Q., Sicinska E., Geng Y., Ahnstrom M., Zagozdzon A., Kong Y., Gardner H., Kiyokawa H., Harris LN., Stal O., Sicinski P. Cancer - Interactions investigated in the context of cancer peter_sicinski@dfci.harvard.edu Only protein-protein interactions 6 mouse-mammary gland Mus musculus mammary gland mammary_gland mammary gland anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yu Q., Sicinska E., Geng Y., Ahnstrom M., Zagozdzon A., Kong Y., Gardner H., Kiyokawa H., Harris LN., Stal O., Sicinski P. Cancer - Interactions investigated in the context of cancer peter_sicinski@dfci.harvard.edu Accepted 2006-OCT-9 by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 6 imex curation ccnd1_mouse G1/S-specific cyclin-D1 Ccnd1 Cyl-1 protein protein mouse Mus musculus Mouse MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI DIP protein P25322 original sequence version: 139 DIP protein P25322 original sequence version: 123 DIP protein P25322 original sequence version: 75 3A79736B4163251B cdk2_mouse Cyclin-dependent kinase 2 Cdk2 Cell division protein kinase 2 Cdkn2 protein protein mouse Mus musculus Mouse MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSAPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL DIP protein P97377 original sequence version: 140 D806BC2F150AEDFC cdk6_mouse Cyclin-dependent kinase 6 Serine/threonine-protein kinase PLSTIRE Cdkn6 Cdk6 Crk2 Cell division protein kinase 6 CR2 protein kinase protein protein mouse Mus musculus Mouse MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLERYKDNLNSHLPSNQSTSELNTA 127B7ECFFC54C3AC ccnd3_mouse G1/S-specific cyclin-D3 Ccnd3 Cyl-3 protein protein mouse Mus musculus Mouse MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQKEIKPHMRKMLAYWMLEVCEEQRCEEDVFPLAMNYLDRYLSCVPTRKAQLQLLGTVCLLLASKLRETTPLTIEKLCIYTDQAVAPWQLREWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPSDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVLGLGACSMSADELTELLAGITGTEVDCLRACQEQIEAALRESLREAAQTAPSPVPKAPRGSSSQGPSQTSTPTDVTAIHL 5441639A9B1B1475 ccnd2_mouse G1/S-specific cyclin-D2 Ccnd2 Cyl-2 protein protein mouse Mus musculus Mouse MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDDEVNTLTCDALTELLAKITHTDVDCLKACQEQIEALLLNSLQQFRQEQHNAGSKSVEDPDQATTPTDVRDVDL DIP protein P30280 original sequence version: 108 58F322771DD1DA3D cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE DIP protein P30285 original sequence version: 145 DIP protein P30285 original sequence version: 129 DIP protein P30285 original sequence version: 82 DIP protein P30285 original sequence version: 102 CB4F42A8AA13634A cdn1b_mouse Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 Cdkn1b protein protein mouse Mus musculus Mouse MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT DIP protein P46414 original sequence version: 87 BAC30D648B9BA3D6 ccnd1-cdk2 1 2 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey association association 1 B We found that, in wild-type glands, cyclin D1 associated with CDK4, CDK6, CDK2, and p27Kip1 (Figure 1B). In CDK4 null mammary glands that were stimulated by hormones to undergo lobuloalveolar development, cyclin D1 associated with CDK6, CDK2, and p27Kip1 This interaction was found in mammary glands of pregnant wild-type mice and in mammary glands of wild-type female mice that were hormonally stimulated to undergo lobuloalveolar development. In Cdk4 null mammary glands that were stimulated by hormones to undergo lobuloalveolar development, cyclin D1 associated with all of these proteins except for Cdk4. ccnd1-cdk4-1 1 2 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 3 B These complexes form in mammary glands from day 13.5 mouse embryos. cdk4-ccnd1-8 1 7 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 3 C These complexes form in mammary glands from day 13.5 mouse embryos. The band for cyclin D3 is lighter than for the other forms of cyclin D. There is a double band for cyclin D1. ccnd1-cdk4-3 1 2 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 3 B These complexes form in mammary tumours arising in MMTV-ErbB-2 mice. Immunoprecipitation analyses revealed the presence of abundant cyclin D1-CDK4 complexes in ErbB-2-driven mammary carcinomas cdk4-ccnd1-9 1 7 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association 3 C These complexes form in mammary tumours arising in MMTV-ErbB-2 mice. There is a double band for cyclin D1. Immunoprecipitation analyses revealed the presence of abundant cyclin D1-CDK4 complexes in ErbB-2-driven mammary carcinomas ccnd1-cdk2-1 1 8 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey association association 1 B right panel In CDK4 null mammary glands that were stimulated by hormones to undergo lobuloalveolar development, cyclin D1 associated with CDK6, CDK2, and p27Kip1 This interaction was in mammary glands of CDK4 null female mice that were hormonally stimulated to undergo lobuloalveolar development.