IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A beta-arrestin binding determinant common to the second intracellular loops of rhodopsin family G protein-coupled receptors. A beta-arrestin binding determinant common to the second intracellular loops of rhodopsin family G protein-coupled receptors. J. Biol. Chem. (0021-9258) 2006 imex curation Marion S., Oakley RH., Kim KM., Caron MG., Barak LS. BioCreative - Critical Assessment of Information Extraction systems in Biology caron002@mc.duke.edu,l.barak@cellbio.duke.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Marion S., Oakley RH., Kim KM., Caron MG., Barak LS. BioCreative - Critical Assessment of Information Extraction systems in Biology caron002@mc.duke.edu,l.barak@cellbio.duke.edu Accepted 2006-SEP-18 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation 5ht2c_human 5-hydroxytryptamine receptor 2C 5-hydroxytryptamine receptor 1C Serotonin receptor 2C HTR2C HTR1C protein protein human Homo sapiens Human MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV 9E76B3FFD3E09C93 arrb2_mouse Beta-arrestin-2 Arrestin beta-2 Arrb2 protein protein mouse Mus musculus Mouse MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQSAPRETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDCDDQFC DIP protein Q91YI4 original sequence version: 115 DIP protein Q91YI4 original sequence version: 105 DIP protein Q91YI4 original sequence version: 92 DIP protein Q91YI4 original sequence version: 71 0DFA73A1C532AE03 htr2c-arrb2 1 2 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P28335:p.Pro159Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:49:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro159ala' Tue Jun 30 20:18:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro159Ala' 3 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The biosource for P28335; HTR2C determined from previous work from the authors and crossreference in ref 20 in article. 3C, 3D Under basal conditions an alanine substitution of Pro-9 led to a 4-fold decrease in the amount of beta-arrestin2-GFP co-immunoprecipitated by the 5HT2cR G protein source not disclosed. G protein coupling to 5HT2cR was also affected by the substitution of proline to alanine at position 159.