MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014za-1 A novel β-trefoil lectin from the parasol mushroom (Macrolepiota procera) is nematotoxic in vitro In vitro bn-page blue native page bn-page weight by staining molecular weight estimation by staining weight by staining jerica.sabotic@ijs.si 2014 imex curation Zurga S., Pohleven J., Renko M., Bleuler-Martinez S., Sosnowski P., Turk D., Künzler M., Kos J., Sabotič J. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014y-2 A novel β-trefoil lectin from the parasol mushroom (Macrolepiota procera) is nematotoxic in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined jerica.sabotic@ijs.si 2014 imex curation Zurga S., Pohleven J., Renko M., Bleuler-Martinez S., Sosnowski P., Turk D., Künzler M., Kos J., Sabotič J. FEBS J. (1742-464X) Only protein-protein interactions f6kmv5_macpc protein protein macpc Macrolepiota procera MSTQVSSGQTYKITNVKAGTVIDLSGEDNKSIIGYPYHSGKNQQWTFNWTGKAWTLRSASSGSYLGIEGTPADGTRLVAVNDPFEWHIWRDEANENAFRIFVPFTNYNLDLSGYGDTTPGTPVQLWWTWEGLHQTWTIDRP f6kmv5 1547033 n/a rMpL 1547035 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 physical association physical association false false false f1c f6kmv5-1 1547033 n/a rMpL 1547035 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified F6KMV5:p.[Ile22Arg;Gly113Ser;Thr128His;Leu132Asn] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 6.0 physical association physical association false false false f1c Non-mutated lectins (nMpL, rMpL) exhibited a prominent band at 35-40 kDa, indicating the presence of a dimer (Figure 1C, lanes 1 and 2), similarly to rCNL (Figure 1C, lane 8), which is known to form a dimer [10]. Interestingly, mutants D22R and GAMMA showed the presence of a higher oligomer, possibly a hexamer. f6kmv5-1 1547033 n/a rMpL 1547035 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified F6KMV5:p.Ile22Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 6.0 physical association physical association false false false f1c Non-mutated lectins (nMpL, rMpL) exhibited a prominent band at 35-40 kDa, indicating the presence of a dimer (Figure 1C, lanes 1 and 2), similarly to rCNL (Figure 1C, lane 8), which is known to form a dimer [10]. Interestingly, mutants D22R and GAMMA showed the presence of a higher oligomer, possibly a hexamer. f6kmv5-1 1547034 n/a rMpL 1547035 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 physical association physical association false false false f6 t2