MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2013p-1 Amino acid residues crucial for specificity of toxin-antitoxin interactions in the homologous Axe-Txe and YefM-YoeB complexes ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Połom D., Boss L., Węgrzyn G., Hayes F., Kędzierska B. barbara.kedzierska@biol.ug.edu.pl FEBS J. (1742-464X) 2013 Only protein-protein interactions imex curation yefm_ecoli Antitoxin YefM yefM b2017 JW5835 protein protein ecoli Escherichia coli (strain K12) MRTISYSEARQNLSATMMKAVEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANARRLMDSIDSLKSGKGTEKDIIE yoeb_ecoli Toxin YoeB yoeB Putative endoribonuclease YoeB Putative mRNA interferase Yoeb b4539 JW5331 protein protein ecoli Escherichia coli (strain K12) MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY d4rlg7_entfc Putative mRNA interferase YoeB Toxin YoeB EfmE1679_2786 protein protein enterococcus faecium e1679 Enterococcus faecium E1679 MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYSAKDHY The sequence has been withdrawn from uniprot. d4rlg8_entfc Antitoxin EfmE1679_2787 protein protein enterococcus faecium e1679 Enterococcus faecium E1679 MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTHDLIEVESDD The sequence has been withdrawn from uniprot. yefm-yoeb 1437229 n/a YefM 1437230 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a YoeB 1437231 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1 f4b f6 sf1 yefm-yoeb-1 1437229 n/a Txe 1437232 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Axe 1437233 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1 f4a sf1