IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ liu-2010b-1 Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Superdex-200 x-he@northwestern.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation liu-2010b-3 Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Superdex-200 x-he@northwestern.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation liu-2010b-2 Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Superdex-200 x-he@northwestern.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation sema_vaccc Semaphorin-like protein A39 A39R protein protein vaccc Vaccinia virus (strain Copenhagen) (VACV) VACV MIPLLFILFYFANGIEWHKFETSEEIISTYLLDDVLYTGVNGAVYTFSNNKLNKTGLTNNNYITTSIKVEDADKDTLVCGTNNGNPKCWKIDGSDDPKHRGRGYAPYQNSKVTIISYNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGLRGAFVDKDGTYDKVYILFTDTIGSKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSRTIKTDNDTILYVFFDSPYSKSALCTYSMNTIKQSFSTSKLEGYTKQLPSPAPGICLPAGKVVSHTTFEVIEKYNVLDDIIKPLSNQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENSIYSFDTKSKQTRSSQVDARLFSVMVTSKPLFIADIGIGVGMPQMKKILKM plxc1_human Plexin-C1 PLXNC1 VESPR Virus-encoded semaphorin protein receptor protein protein human Homo sapiens Human MEVSRRKAPPRPPRPAAPLPLLAYLLALAAPGRGADEPVWRSEQAIGAIAASQEDGVFVASGSCLDQLDYSLEHSLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGAAGLGGLLLTGWTFDRGACEVRPLGNLSRNSLRNGTEVVSCHPQGSTAGVVYRAGRNNRWYLAVAATYVLPEPETASRCNPAASDHDTAIALKDTEGRSLATQELGRLKLCEGAGSLHFVDAFLWNGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFKTAESHCKEGDQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIKEETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDPHCGWCHSLQRCTFQGDCVHSENLENWLDISSGAKKCPKIQIIRSSKEKTTVTMVGSFSPRHSKCMVKNVDSSRELCQNKSQPNRTCTCSIPTRATYKDVSVVNVMFSFGSWNLSDRFNFTNCSSLKECPACVETGCAWCKSARRCIHPFTACDPSDYERNQEQCPVAVEKTSGGGRPKENKGNRTNQALQVFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGTSTCDKDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQNITMMGRNFDVIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQDTYLDCGTLQYREDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQDLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQLLHVKVLFDEKKKCKWM sem7a_human Semaphorin-7A SEMA7A CD108 SEMAL Semaphorin-L Semaphorin-K1 John-Milton-Hargen human blood group Ag JMH blood group antigen CDw108 protein protein human Homo sapiens Human MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPNPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVH sema_ectvm Semaphorin-like protein 139 EVM139 SEMA protein protein ectvm Ectromelia virus (strain Moscow) MIPLLFILFYFTNCIEWHKFETSEEIISTYLIDDVLYTGVNGAVYTFSNNELNKTGLTNNNNYITTSIKVEDTLVCGTNNGNPKCWKIDGSEDPKYRGRGYAPYQNSKVTIISHNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGVRGAFVDKDGTYDKVYILFTDTIDTKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSKAIKTDNDTILYVFFDSPYSKSALCTYSMNAIKHSFSTSKLGGYTKQLPSPAPGICLPAGKVVPHTTFDIIEQYNELDDIIKPLSQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENTIYSFDTKSKQTRSAQVDARLFSVMVTSKPLFIADIGIGVGIPRMKKILKM plxnc1-sem7a-1 Binding of SEM7A to PLXNC1 and EVM139 (A39R) 983716 n/a 983719 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 983720 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 983721 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 1D Temp=30C plxnc1-sem7a-2 Binding of SEM7A to PLXNC1 and truncated SEM7A 983716 n/a 983720 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 983721 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 983720 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 1B Temp=30C plxnc1-sem7a-3 Binding of SEM7A to PLXNC1 983716 n/a 983721 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 983720 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false Fig. 1C Temp=30C plxnc1-emv139-1 Binding of PLXNC1 to EVM139 (A39R) 983716 n/a 983719 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 983721 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction false false false Fig. 1E Temp=30C plxnc1-emv139-2 Binding of PLXNC1 to EVM139 (A39R) 983717 n/a 983721 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 983719 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 983761 983758 direct interaction direct interaction false false false Supp. Table 1 2.3A R-working:23.9% R-free:27.6% plxnc1-sem7a-4 Binding of SEM7A to PLXNC1 983717 n/a 983721 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 983720 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 983767 983765 direct interaction direct interaction false false false Supp. Table 1 2.14A R-working:24.8% R-free:27.7% a39-1 Homodimerisation of A39 983717 n/a 983722 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 2.0 direct interaction direct interaction false false false 2.3A R-working:23.9% R-free:27.6% Supp. Table 1 sem7a-1 Homodimerisation of SEM7A 983718 n/a 983720 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. Stoichiometry: 2.0 direct interaction direct interaction false false false N-linked glycans have been removed prior to purification. Supp. Fig. 1 emv139-1 Homodimerisation of EVM139 (A39R) 983718 n/a 983719 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 1 MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint butler_cole-2007-1 An ectromelia virus profilin homolog interacts with cellular tropomyosin and viral A-type inclusion protein. unknown Unknown fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Butler-Cole C., Wagner MJ., Da Silva M., Brown GD., Burke RD., Upton C. Virus - Publications including interactions involving viral proteins chris.butlercole@gmail.com Virol. J. 2007 rapid curation rapid curation butlerco-2007-1 An ectromelia virus profilin homolog interacts with cellular tropomyosin and viral A-type inclusion protein. unknown Unknown ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Butler-Cole C., Wagner MJ., Da Silva M., Brown GD., Burke RD., Upton C. Virus - Publications including interactions involving viral proteins chris.butlercole@gmail.com Virol. J. 2007 rapid curation rapid curation b1mty0_plemo TPM3 protein protein calmo Callicebus moloch MEFQEIQLKEAKHTAKEADRKYEEVVRELVITEGDLGCTEELAELAVSRCQKKDEQIRLTDQNLKCLSAAEEKYFPKEEKYEEEIKILTDKLKEAETCAEFSERQVATLEKTTDDLEDKLKCTKEENLCTQRMLDQTLLDLNEIQNTPVLPCCCSLCP mint prof_ectvm Profilin EVM141 protein protein ectvm Ectromelia virus (strain Moscow) MAAEWHKIIEDVSKNNKFEDAAIVDYKTKKNVLAAIPNRTFAKIIPGEVIALITNRNILKPRIGQKFFIVYTNSLMDENTYTMELLTGYAPVSPIVIARTHTALIFLMGKPTTSRREVYRTCRDYATNVRATGN More likely to influence phosphoinositide metabolism than actin assembly mint ati_vaccw A-type inclusion protein A25 A25 VACWR148 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MEVTNLIEKCTKHSKDFATEVKKLWNDELSSESGLSRKTRNVIRNILRDITKSLTTDKKSKCFRILERSTINGEQIKDVYKTIFNNGVDVESRINTTGKYVLFTVMTYVAAELRLIKSDEIFALLSRFFNMICDIHRKYGCGNMFVGIPAALIILLEIDHINKLFSVFSTRYDAKAYLYTEYFLFLNINHYLLSGSDLFINVAYGAVSFSSPISVPDYIMEALTFKACDHIMKSGDLKYTYAFTKKVKDLFNTKSDSIYQYVRLHEMSYDGVSEDTDDDDEVFAILNLSIDSSVDRYRNRVLLLTPEVASLRKEYSDVEPDYKYLMDEEVPAYDKHLPKPITNTGIEEPHATGGDEDQPIKVVHPPNNDKDDAIKPYNPLEDPNYVPTITRTAIGIADYQLVINKLIEWLDKCEEECGNSGEFKTELEEAKRKLTELNAELSDKLSKIRTLERDSVYKTERIDRLTKEIKEHRDIQNGTDDGSDLLEIDKKTIRELRESLDREREMRSELEKELDTIRNGKVDGSCQRELELSRMWLKQRDDDLRAEIDKRRNVEWELSRLRRDIKECDKYKEDLDKAKTTISNYVSKISTLESEIAKYQQDRDTLSVVRRELEEERRRVRDLESRLDECTRNQEDTQEVDALRSRIRELENKLTDCIESGGGNLTEISRLQSKISDLERQLSECRENATEISRLQSRISDLERQLNDCRRNNETNAETERDATS mint Mature viruses are occluded into the ATI, and it has been assumed that such bodies protect the virus during dissemination from animal to animal prof-ati 759638 ati1_vaccw 759640 unspecified role unspecified role neutral component neutral component ati1_vaccw 759640 unspecified role unspecified role prey prey prof_ectvm 759641 unspecified role unspecified role bait bait prof_ectvm 759641 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false F5 F9 homomint mint prof-tpm3 759639 prof_ectvm 759641 unspecified role unspecified role bait bait b1mty0_calmo 759642 unspecified role unspecified role prey prey physical association physical association false false false F5 mint