IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ okamoto-1997-1 Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu rat brain cDNA library (postnatal day 8) J. Biol. Chem. (0021-9258) 1997 Only protein-protein interactions imex curation okamoto-1997-2 Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu rat brain cDNA library (postnatal day 8) J. Biol. Chem. (0021-9258) 1997 Only protein-protein interactions imex curation okamoto-1997-3 Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu rat brain cDNA library (postnatal day 8) J. Biol. Chem. (0021-9258) 1997 Only protein-protein interactions imex curation okamoto-1997-4 Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu rat brain cDNA library (postnatal day 8) J. Biol. Chem. (0021-9258) 1997 Only protein-protein interactions imex curation apba1_rat Amyloid-beta A4 precursor protein-binding family A member 1 Neuron-specific X11 protein Neuronal Munc18-1-interacting protein 1 Adapter protein X11alpha Apba1 Mint1 X11 protein protein rat Rattus norvegicus (Rat) Rat MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPSPPPPAGHAPEDHRAHPAPPPPPPPQEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYAVQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRAEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSITPLHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI stxb1_rat Syntaxin-binding protein 1 Stxbp1 Unc18a Protein unc-18 homolog 1 Protein unc-18 homolog A N-Sec1 rbSec1 p67 protein protein rat Rattus norvegicus (Rat) Rat MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS apba2_rat Amyloid-beta A4 precursor protein-binding family A member 2 Apba2 Mint2 Neuron-specific X11L protein Neuronal Munc18-1-interacting protein 2 Adapter protein X11beta protein protein rat Rattus norvegicus (Rat) Rat MAHRKRQSTASSMLDHRARPGPIPHDQEPENEDTELPLESYVPTGLELGTLRPDSPTPEEQECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGVTYYIRYCPEDDSYLEGMDCNGEEYLAHGAHPVDTDECQEAVEDWTDSVGPHTHSHGAENSQEYPDSHLPIPEDDPTVLEVHDQEEDGHYCPSKESYQDYYPPETNGNTGGASPYRMRRGDGDLEEQEEDIDQIVAEIKMSLSMTSITSASEASPEHMPELDPGDSTEACSPSDTGRGPSRQEARPKSLNLPPEVKHSGDPQRGLKTKTRTPEERPKWPQEQVCNGLEQPRKQQRSDLNGPTDNNNIPETKKVASFPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL stx5_rat Syntaxin-5 Stx5 Stx5a protein protein rat Rattus norvegicus (Rat) Rat MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAINSSSDIAPLPTPVALVPSPPDTMSCRDRTQEFLSACKSLQSRQNGIQTNKPALHATRQCSEFTLMARRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRNRREQFSRAPVSALPLAPNNLGGGPIVLGGESRASRDVAIDMMDPRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG apba1-stxbp1 773645 n/a 773649 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 773650 unspecified role unspecified role bait bait physical association physical association false false false 1 munc18-mint2 773645 n/a 773651 unspecified role unspecified role prey prey n/a 773650 unspecified role unspecified role bait bait physical association physical association false false false 1a munc18-psd95 773645 n/a 773652 unspecified role unspecified role prey prey n/a 773650 unspecified role unspecified role bait bait physical association physical association false false false munc18-syntaxin_5 773645 n/a 773650 unspecified role unspecified role bait bait n/a 773653 unspecified role unspecified role prey prey physical association physical association false false false mint1-munc18 773646 n/a 773649 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 773650 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] association association false false false 2 Both Mint columns as the major component and syntaxin 1 as a minor component however mapping of syntaxin was not possible since the variant detected not clear from the publication. mint2-munc18-1 773646 n/a 773650 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] n/a 773651 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false 2 Both Mint columns as the major component and syntaxin 1 as a minor component however mapping of syntaxin was not possible since the variant detected not clear from the publication. munc18-mint1 773647 n/a 773654 unspecified role unspecified role prey prey n/a 773650 unspecified role unspecified role prey prey n/a 773649 unspecified role unspecified role bait bait physical association physical association false false false 3 munc18-mint2-1 773647 n/a 773650 unspecified role unspecified role prey prey n/a 773654 unspecified role unspecified role prey prey n/a 773651 unspecified role unspecified role bait bait physical association physical association false false false 3 mint1-munc18-1 773648 n/a 773650 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 n/a 773649 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 4 mint1-munc18-2 773648 n/a 773649 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 773650 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 n/a 773654 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association false false false 4