IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rosenbluh-2012-4 β-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis. human-hutu80 Human duodenum adenocarcinoma HuTu80 hutu80 Human duodenum adenocarcinoma HuTu80 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Rosenbluh J., Nijhawan D., Cox A.G., Li X., Neal J.T., Schafer E.J., Zack T.I., Wang X., Tsherniak A., Schinzel A.C., Shao D.D., Schumacher S.E., Weir B.A., Vazquez F., Cowley G.S., Root D.E., Mesirov J.P., Beroukhim R., Kuo C.J., Goessling W., Hahn W.C. Cancer - Interactions investigated in the context of cancer william_hahn@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation rosenbluh-2012-7 β-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Rosenbluh J., Nijhawan D., Cox A.G., Li X., Neal J.T., Schafer E.J., Zack T.I., Wang X., Tsherniak A., Schinzel A.C., Shao D.D., Schumacher S.E., Weir B.A., Vazquez F., Cowley G.S., Root D.E., Mesirov J.P., Beroukhim R., Kuo C.J., Goessling W., Hahn W.C. Cancer - Interactions investigated in the context of cancer william_hahn@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation rosenbluh-2012-1 β-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis. human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosenbluh J., Nijhawan D., Cox A.G., Li X., Neal J.T., Schafer E.J., Zack T.I., Wang X., Tsherniak A., Schinzel A.C., Shao D.D., Schumacher S.E., Weir B.A., Vazquez F., Cowley G.S., Root D.E., Mesirov J.P., Beroukhim R., Kuo C.J., Goessling W., Hahn W.C. Cancer - Interactions investigated in the context of cancer william_hahn@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation rosenbluh-2012-2 β-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rosenbluh J., Nijhawan D., Cox A.G., Li X., Neal J.T., Schafer E.J., Zack T.I., Wang X., Tsherniak A., Schinzel A.C., Shao D.D., Schumacher S.E., Weir B.A., Vazquez F., Cowley G.S., Root D.E., Mesirov J.P., Beroukhim R., Kuo C.J., Goessling W., Hahn W.C. Cancer - Interactions investigated in the context of cancer william_hahn@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation rosenbluh-2012-3 β-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis. human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Rosenbluh J., Nijhawan D., Cox A.G., Li X., Neal J.T., Schafer E.J., Zack T.I., Wang X., Tsherniak A., Schinzel A.C., Shao D.D., Schumacher S.E., Weir B.A., Vazquez F., Cowley G.S., Root D.E., Mesirov J.P., Beroukhim R., Kuo C.J., Goessling W., Hahn W.C. Cancer - Interactions investigated in the context of cancer william_hahn@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation rosenbluh-2012-5 β-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis. human-hutu80 Human duodenum adenocarcinoma HuTu80 hutu80 Human duodenum adenocarcinoma HuTu80 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rosenbluh J., Nijhawan D., Cox A.G., Li X., Neal J.T., Schafer E.J., Zack T.I., Wang X., Tsherniak A., Schinzel A.C., Shao D.D., Schumacher S.E., Weir B.A., Vazquez F., Cowley G.S., Root D.E., Mesirov J.P., Beroukhim R., Kuo C.J., Goessling W., Hahn W.C. Cancer - Interactions investigated in the context of cancer william_hahn@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation rosenbluh-2012-6 β-Catenin-driven cancers require a YAP1 transcriptional complex for survival and tumorigenesis. human-hutu80 Human duodenum adenocarcinoma HuTu80 hutu80 Human duodenum adenocarcinoma HuTu80 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Rosenbluh J., Nijhawan D., Cox A.G., Li X., Neal J.T., Schafer E.J., Zack T.I., Wang X., Tsherniak A., Schinzel A.C., Shao D.D., Schumacher S.E., Weir B.A., Vazquez F., Cowley G.S., Root D.E., Mesirov J.P., Beroukhim R., Kuo C.J., Goessling W., Hahn W.C. Cancer - Interactions investigated in the context of cancer william_hahn@dfci.harvard.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation tbx5_human T-box transcription factor TBX5 TBX5 protein protein human Homo sapiens Human MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS yap1_human Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL bcl2l1_human_gene Human Bcl-2-like protein 1 gene gene gene human Homo sapiens Human birc5_human_gene Baculoviral IAP repeat-containing protein 5 gene gene gene human Homo sapiens Human ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL yes_human Tyrosine-protein kinase Yes p61-Yes Proto-oncogene c-Yes YES1 YES protein protein human Homo sapiens Human MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL ctnb1_mouse Catenin beta-1 Beta-catenin Ctnnb1 Catnb protein protein mouse Mus musculus Mouse MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL p46937-3 Transcriptional coactivator YAP1 YAP1 YAP65 Protein yorkie homolog Yes-associated protein YAP65 homolog YAP1-1beta protein protein human Homo sapiens Human MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL yap1-bcl2l1-1 1374259 n/a 1374266 unspecified role unspecified role ancillary ancillary n/a 1374267 unspecified role unspecified role bait bait n/a 1374268 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4E, 4G Interaction not observed in TBX5-/- cells yap1-birc5-1 1374259 n/a 1374266 unspecified role unspecified role ancillary ancillary n/a 1374269 unspecified role unspecified role prey prey n/a 1374267 unspecified role unspecified role bait bait association association false false false Fig. 4E, 4G Interaction not observed in TBX5-/- cells ctnnb1-bcl2l1-1 1374259 n/a 1374270 unspecified role unspecified role bait bait n/a 1374268 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1374266 unspecified role unspecified role ancillary ancillary association association false false false Fig. 4E, 4F Interaction not observed in TBX5-/- cells ctnnb1-birc5-1 1374259 n/a 1374270 unspecified role unspecified role bait bait n/a 1374269 unspecified role unspecified role prey prey n/a 1374266 unspecified role unspecified role ancillary ancillary association association false false false Fig. 4E, 4F Interaction not observed in TBX5-/- cells yap1-bcl2l1-2 1374260 n/a 1374267 unspecified role unspecified role bait bait n/a 1374268 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6F Dasatinib yap1-birc5-2 1374260 n/a 1374267 unspecified role unspecified role bait bait n/a 1374269 unspecified role unspecified role prey prey association association false false false Fig. 6F Dasatinib ctnnb1-birc5-2 1374260 n/a 1374269 unspecified role unspecified role prey prey n/a 1374270 unspecified role unspecified role bait bait association association false false false Fig. 6F Dasatinib ctnnb1-bcl2l1-2 1374260 n/a 1374270 unspecified role unspecified role bait bait n/a 1374268 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6F Dasatinib ctnnb1-yap1 1374261 n/a 1374270 unspecified role unspecified role bait bait n/a 1374267 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3A yap1-yes1 1374261 n/a 1374271 unspecified role unspecified role prey prey n/a 1374267 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5E yap1-ctnnb1 1374261 n/a 1374267 unspecified role unspecified role bait bait n/a 1374270 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6B Protein kinase inhibitor dasatinib tbx5-ctnnb1-1 1374262 n/a 1374272 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1374266 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3E tbx5-yap1 1374262 n/a 1374267 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1374266 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 3E yap1-ctnnb1-1 1374262 n/a 1374272 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1374267 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 6D tbx5-ctnnb1 1374263 n/a 1374267 unspecified role unspecified role prey prey n/a 1374270 unspecified role unspecified role prey prey n/a 1374266 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig. 3F yap1-ctnnb1-2 1374263 n/a 1374273 unspecified role unspecified role bait bait P46937-3:p.Tyr357Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false n_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1374270 unspecified role unspecified role prey prey physical association physical association false false false Fig 6E ctnnb1-yap1-1 1374264 n/a 1374270 unspecified role unspecified role bait bait n/a 1374267 unspecified role unspecified role prey prey n/a 1374271 unspecified role unspecified role ancillary ancillary association association false false false Fig. 6A Interaction not observed in yes-/- cells ctnnb1-yap1-2 1374264 n/a 1374270 unspecified role unspecified role bait bait n/a 1374267 unspecified role unspecified role prey prey association association false false false Fig. 6C The dasatinib-induced increase in β-catenin-YAP1 interaction was reversed by expression of a dasatinib-resistant form of YES1 or SRC Dasatinib yap1-ctnnb1-3 1374265 n/a 1374270 unspecified role unspecified role prey prey n/a 1374273 unspecified role unspecified role bait bait n_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P46937-3:p.Tyr357Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6E