IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ojeda-2006-1 Role of glutaredoxin-3 and glutaredoxin-4 in the iron regulation of the Aft1 transcriptional activator in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ojeda L., Keller G., Muhlenhoff U., Rutherford JC., Lill R., Winge DR. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay Figure 6 dennis.winge@hsc.utah.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation ojeda-2006-2 Role of glutaredoxin-3 and glutaredoxin-4 in the iron regulation of the Aft1 transcriptional activator in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ojeda L., Keller G., Muhlenhoff U., Rutherford JC., Lill R., Winge DR. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay Figure 6 dennis.winge@hsc.utah.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation glrx3_yeast Monothiol glutaredoxin-3 YD8557.05C GRX3 YDR098C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPVIEINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCKNSVNSGSSQTHTMENANVNEGSHNDEDDDDEEEEEETEEQINARLTKLVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVRQNLKKFSEWPTFPQLYINGEFQGGLDIIKESLEEDPDFLQHALQS 8CC1A04EC1E7DAB3 aft1_yeast Iron-regulated transcriptional activator AFT1 AFT1 RCS1 Activator of iron transcription protein 1 YGL071W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEGFNPADIEHASPINSSDSHSSSFVYALPKSASEYVVNHNEGRASASGNPAAVPSPIMTLNLKSTHSLNIDQHVHTSTSPTETIGHIHHVEKLNQNNLIHLDPVPNFEDKSDIKPWLQKIFYPQGIELVIERSDAFKVVFKCKAAKRGRNARRKRKDKPKGQDHEDEKSKINDDELEYASPSNATVTNGPQTSPDQTSSIKPKKKRCVSRFNNCPFRVRATYSLKRKRWSIVVMDNNHSHQLKFNPDSEEYKKFKEKLRKDNDVDAIKKFDELEYRTLANLPIPTATIPCDCGLTNEIQSFNVVLPTNSNVTSSASSSTVSSISLDSSNASKRPCLPSVNNTGSINTNNVRKPKSQCKNKDTLLKRTTMQNFLTTKSRLRKTGTPTSSQHSSTAFSGYIDDPFNLNEILPLPASDFKLNTVTNLNEIDFTNIFTKSPHPHSGSTHPRQVFDQLDDCSSILFSPLTTNTNNEFEGESDDFVHSPYLNSEADFSQILSSAPPVHHDPNETHQENQDIIDRFANSSQEHNEYILQYLTHSDAANHNNIGVPNNNSHSLNTQHNVSDLGNSLLRQEALVGSSSTKIFDELKFVQNGPHGSQHPIDFQHVDHRHLSSNEPQVRSHQYGPQQQPPQQLQYHQNQPHDGHNHEQHQTVQKDMQTHESLEIMGNTLLEEFKDIKMVNGELKYVKPED glrx4_yeast Monothiol glutaredoxin-4 GRX4 SYGP-ORF64 YER174C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLSIDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAKGPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGILREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQHALQ 86B4C4993545B5B2 grx3-aft1 Yeast 2 hybrid analysis reveals interaction between Grx3 protein and AFT1 protein 367023 N/A 367025 unspecified role unspecified role bait bait Q03835:p.Cys176Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 367026 unspecified role unspecified role prey prey physical association physical association false false false grx4-aft1 Yeast 2 hybrid analysis reveals interaction between Grx4 protein and AFT1 protein 367023 N/A 367026 unspecified role unspecified role prey prey N/A 367027 unspecified role unspecified role bait bait P32642:p.Cys171Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false grx3-aft1-1 Coimmunoprecipitation analysis reveals interaction between Grx3 protein and AFT1 protein 367024 N/A 367026 unspecified role unspecified role prey prey region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 367025 unspecified role unspecified role bait bait c terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Tap tagged AFT1 was not coimmunoprecipitated when HIS tagged Grx3 was used in these studies. grx4-aft1-1 Coimmunoprecipitation analysis reveals interaction between Grx4 protein and AFT1 protein 367024 N/A 367026 unspecified role unspecified role prey prey region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 367027 unspecified role unspecified role bait bait c terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Tap tagged AFT1 was not coimmunoprecipitated when HIS tagged Grx4 was used in these studies.