IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lange-2006-1 ClC-7 requires Ostm1 as a beta-subunit to support bone resorption and lysosomal function. mouse-fibroblast Mus musculus fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Lange PF., Wartosch L., Jentsch TJ., Fuhrmann JC. BioCreative - Critical Assessment of Information Extraction systems in Biology Jentsch@zmnh.uni-hamburg.de Nature (0028-0836) 2006 Only protein-protein interactions imex curation lange-2006-2 ClC-7 requires Ostm1 as a beta-subunit to support bone resorption and lysosomal function. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lange PF., Wartosch L., Jentsch TJ., Fuhrmann JC. BioCreative - Critical Assessment of Information Extraction systems in Biology Jentsch@zmnh.uni-hamburg.de Nature (0028-0836) 2006 Only protein-protein interactions imex curation lange-2006-5 ClC-7 requires Ostm1 as a beta-subunit to support bone resorption and lysosomal function. mouse-osteoclast Mouse osteoclast osteoclast Osteoclast Large multinucleate cell formed from differentiated macrophage, responsible for breakdown of bone. fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Lange PF., Wartosch L., Jentsch TJ., Fuhrmann JC. BioCreative - Critical Assessment of Information Extraction systems in Biology Jentsch@zmnh.uni-hamburg.de Nature (0028-0836) 2006 Only protein-protein interactions imex curation lange-2006-3 ClC-7 requires Ostm1 as a beta-subunit to support bone resorption and lysosomal function. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lange PF., Wartosch L., Jentsch TJ., Fuhrmann JC. BioCreative - Critical Assessment of Information Extraction systems in Biology Jentsch@zmnh.uni-hamburg.de Nature (0028-0836) 2006 Only protein-protein interactions imex curation lange-2006-4 ClC-7 requires Ostm1 as a beta-subunit to support bone resorption and lysosomal function. mouse-purkinje cell Mus musculus brain-purkinje_cell Purkinje cell Purkinje cells can be found either as 1] Purkinje fibers in the inner ventricular walls of the heart, that conduct an electrical stimulus that enables the heart to contract in a coordinated fashion - or 2]Purkinje neurons, a class of GABAergic neurons located in the cerebellar cortex. fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Lange PF., Wartosch L., Jentsch TJ., Fuhrmann JC. BioCreative - Critical Assessment of Information Extraction systems in Biology Jentsch@zmnh.uni-hamburg.de Nature (0028-0836) 2006 Only protein-protein interactions imex curation lamp1_mouse Lysosome-associated membrane glycoprotein 1 Lysosomal membrane glycoprotein A 120 kDa lysosomal membrane glycoprotein LGP-120 P2B CD107 antigen-like family member A Lamp1 Lamp-1 protein protein mouse Mus musculus Mouse MAAPGARRPLLLLLLAGLAHGASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI ostm1_mouse Osteopetrosis-associated transmembrane protein 1 Grey-lethal protein Ostm1 Gl Chloride channel 7 beta subunit protein protein mouse Mus musculus Mouse MARDAELARSSGWPWRWLPALLLLQLLRWRCALCALPFTSSRHPGFADLLSEQQLLEVQDLTLSLLQGGGLGPLSLLPPDLPDLEPECRELLMDFANSSAELTACMVRSARPVRLCQTCYPLFQQVAIKMDNISRNIGNTSEGPRCGGSLLTADRMQIVLMVSEFFNSTWQEANCANCLTNNGEDLSNNTEDFLSLFNKTLACFEHNLQGHTYSLLPPKNYSEVCRNCKEAYKNLSLLYSQMQKLNGLENKAEPETHLCIDVEDAMNITRKLWSRTFNCSVTCSDTVSVVAVSVFILFLPVVFYLSSFLHSEQKKRKLILPKRLKSSTSFANIQENAT clcn7_mouse H(+)/Cl(-) exchange transporter 7 Clcn7 Clc7 Chloride channel protein 7 Chloride channel 7 alpha subunit protein protein mouse Mus musculus Mouse MANVSKKVSWSGRDRDDEEGAPLLRRTGQPDEETPLLNGAGPGARQSHSALFRIGQMNNVELDDELLDPEVDPPHTFPKEIPHNEKLLSLKYESLDYDNSENQLFLEEERRINHTAFRTVEIKRWVICALIGILTGLVACFIDIVVENLAGLKYRVIKDNIDKFTEKGGLSFSLLLWATLNSAFVLVGSVIVAFIEPVAAGSGIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEGASFWNQFLTWRIFFASMISTFTLNFVLSIYHGNMWDLSSPGLINFGRFDSEKMAYTIHEIPVFIAMGVVGGILGAVFNALNYWLTMFRIRYIHRPCLQVIEAMLVAAVTATVAFVLIYSSRDCQPLQGSSMSYPLQLFCADGEYNSMAAAFFNTPEKSVVSLFHDPPGSYNPMTLGLFTLVYFFLACWTYGLTVSAGVFIPSLLIGAAWGRLFGISLSYLTGAAIWADPGKYALMGAAAQLGGIVRMTLSLTVIMMEATSNVTYGFPIMLVLMTAKIVGDVFIEGLYDMHIQLQSVPFLHWEAPVTSHSLTAREVMSTPVTCLRRREKVGIIVDVLSDTASNHNGFPVVEDVGDTQPARLQGLILRSQLIVLLKHKVFVERSNMGLVQRRLRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNHNQVVGLVTRKDLARYRLGKGGLEELSLAQT ostm1-lamp1-1 Interaction between OSTM1 and LAMP1 demonstrated by colocalisation 504749 N/A 504754 unspecified role unspecified role neutral component neutral component N/A 504755 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1A ostm1-lamp1-2 Interaction between OSTM1 and LAMP1 demonstrated by colocalisation 504749 N/A 504754 unspecified role unspecified role neutral component neutral component N/A 504755 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Q8BGT0 transfection; Colocalisation required cotransfection with Clc-7 (O70496) 2C ostm1-clcn7-1 Interaction between OSTM1 and Clcn7 demonstrated by colocalisation 504749 N/A 504756 unspecified role unspecified role neutral component neutral component N/A 504755 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false O70496 transfection; O70496 transfection; 2D ostm1-clcn7-2 Interaction between OSTM1 and Clcn7 demonstrated by coimmunoprecipitation 504750 N/A 504756 unspecified role unspecified role prey prey N/A 504755 unspecified role unspecified role bait bait physical association physical association false false false 3D ostm1-clcn7-3 Interaction between OSTM1 and Clcn7 demonstrated by coimmunoprecipitation 504750 N/A 504755 unspecified role unspecified role prey prey N/A 504756 unspecified role unspecified role bait bait physical association physical association false false false 3D Molecular weight analysis suggested a cleaved, lysosomal Ostm1 fragment was pulled down by the Clcn7 antibody. ostm1-clcn7-6 Interaction between OSTM1 and Clcn7 demonstrated by colocalisation 504751 N/A 504756 unspecified role unspecified role neutral component neutral component N/A 504755 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4C tcirg1-clcn7-1 Interaction between OSTM1 and Tcirg1 demonstrated by colocalisation 504751 N/A 504755 unspecified role unspecified role neutral component neutral component N/A 504756 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4D & 4E ostm1-clcn7-4 Interaction between OSTM1 and Clcn7 demonstrated by coimmunoprecipitation 504752 N/A 504756 unspecified role unspecified role prey prey N/A 504755 unspecified role unspecified role bait bait physical association physical association false false false S2 Molecular weight analysis suggested a higher molecular weight form of Ostm1 was pulled down by the Clcn7 antibody. Q8BGT0 transfection; ostm1-clcn7-5 Interaction between OSTM1 and Clcn7 demonstrated by colocalisation 504753 N/A 504756 unspecified role unspecified role neutral component neutral component N/A 504755 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4A