IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gareus-2006-3 Mouse profilin 2 regulates endocytosis and competes with SH3 ligand binding to dynamin 1. in vitro In vitro peptide array peptide array antibody detection identification by antibody antibody detection Gareus R., Di Nardo A., Rybin V., Witke W. BioCreative - Critical Assessment of Information Extraction systems in Biology 32 12-mer peptides covering the entire PRD of dynamin 1 were synthesized on a SPOT membrane witke@embl-monterotondo.it J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. gareus-2006-4 Mouse profilin 2 regulates endocytosis and competes with SH3 ligand binding to dynamin 1. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gareus R., Di Nardo A., Rybin V., Witke W. BioCreative - Critical Assessment of Information Extraction systems in Biology Experiments were done at 20 �C using a two-channel charcoal centerpiece (3-mm path length) at a speed of 55,000 rpm in a Beckman Optima XL-A centrifuge fitted with a four-hole AN-60 rotor. witke@embl-monterotondo.it J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. gareus-2006-1 Mouse profilin 2 regulates endocytosis and competes with SH3 ligand binding to dynamin 1. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gareus R., Di Nardo A., Rybin V., Witke W. BioCreative - Critical Assessment of Information Extraction systems in Biology witke@embl-monterotondo.it J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. gareus-2006-2 Mouse profilin 2 regulates endocytosis and competes with SH3 ligand binding to dynamin 1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gareus R., Di Nardo A., Rybin V., Witke W. BioCreative - Critical Assessment of Information Extraction systems in Biology Bait linked to beads - linkage methodology and composition of beads not stated in publication. witke@embl-monterotondo.it J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. p39053-4 Dynamin-1 BraDnm2 Dnm1 Dnm Kiaa4093 protein protein mouse Mus musculus Mouse MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSRSGQASPSRPESPRPPFDL Contains a phosphoserine at position 857. Contains a phosphoserine at position 851. q9jjv2-1 Profilin-2 Pfn2 Profilin II IIa protein protein mouse Mus musculus Mouse MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF sh3g2_mouse Endophilin-A1 Sh3gl2 Sh3d2a Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A Een1 SH3p4 protein protein mouse Mus musculus Mouse MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSHTGTPKPPGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH vasp_mouse Vasodilator-stimulated phosphoprotein Vasp protein protein mouse Mus musculus Mouse MSETVICSSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIIRGVKYNQATPIFHQWRDARQVWGLNFGSKEDAIQFATGMANALEALEGGGPPPAPAPPAWSAQNGPSPEELEQQKRQPEHMERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPSSGVSGAGHGAGAAPPPAPPLPTAQGPNSGGSGAPGLAAAIAGAKLRKVSKQEEASGGPLAPKAENSRSTGGGLMEEMNAMLARRRKATQVGEKPPKDESASEESEARLPAQSEPVRRPWEKNSTTLPRMKSSSSVTTSEAHPSTPCSSDDSDLERVKQELLEEVRKELQKMKEEIIEVFVQELRKRGSP dyn1_mouse Dynamin-1 Dnm1 Dnm Kiaa4093 protein protein mouse Mus musculus Mouse MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSLGAWRLNSPQGKHENRAGKARL prof2_mouse Profilin-2 Profilin II Pfn2 protein protein mouse Mus musculus Mouse MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF dnm1-pfn2-3 Interaction between Dynamin 1 and Pfn2 identified by peptide array 505621 N/A 505625 unspecified role unspecified role bait bait region (strong binding sites) sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region (weak binding sites) sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 505626 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1F, Table 1 dnm1-sh3gl2-1 Interaction between Dynamin 1 and Sh3gl2 identified by peptide array 505621 N/A 505625 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 505627 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1F, Table 1 vasp-pfn2-1 Interaction between Vasp and Pfn2 identified by peptide array 505621 N/A 505628 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 505626 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1F, Table 1 Positive control dnm1-dnm1-1 Homodimerisation of Dynamin1 identified by ultacentrifugation 505622 N/A 505629 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 2.0 direct interaction direct interaction false false false 1G dnm1-dnm1-2 Stoichiometry of Dynamin1 - profilin2 complex identified by ultacentrifugation 505622 N/A 505629 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 1.0 N/A 505626 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 1G dnm1-pfn2-1 Interaction between Dynamin 1 and Pfn2 identifie by coimmunoprecipitation 505623 N/A 505629 unspecified role unspecified role prey prey N/A 505630 unspecified role unspecified role bait bait physical association physical association false false false 1A dnm1-pfn2-2 Interaction between Dynamin 1 and Pfn2 identified by pulldown 505624 N/A 505629 unspecified role unspecified role prey prey proline rich region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 505626 unspecified role unspecified role bait bait Q9JJV2-1:p.Ser138Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1B, 1C, 1D, 1E Publication describes an isoform of Dynamin-1, Dynamin 1aa, as the recombinant protein but this description cannot be matched to any of the isoforms within UniProtKB. By poly-L-proline, suggesting that the poly-L-proline binding site of profilin is required for dynamin 1 binding. A second Ser-133->Tyr Profilin-2 mutant is described in the paper but the UniProtKB entry already shows a tyrosine in this position.