IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xu-2006a-2 Siah1 interacts with the scaffold protein POSH to promote JNK activation and apoptosis. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xu Z., Sproul A., Wang W., Kukekov N., Greene LA. Apoptosis - Interactions involving proteins with a function related to apoptosis zhxu@genetics.ac.cn Mouse brain. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology xu-2006a-1 Siah1 interacts with the scaffold protein POSH to promote JNK activation and apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Xu Z., Sproul A., Wang W., Kukekov N., Greene LA. Apoptosis - Interactions involving proteins with a function related to apoptosis zhxu@genetics.ac.cn Mouse brain. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology xu-2006a-4 Siah1 interacts with the scaffold protein POSH to promote JNK activation and apoptosis. rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu Z., Sproul A., Wang W., Kukekov N., Greene LA. Apoptosis - Interactions involving proteins with a function related to apoptosis zhxu@genetics.ac.cn Mouse brain. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology xu-2006a-3 Siah1 interacts with the scaffold protein POSH to promote JNK activation and apoptosis. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Xu Z., Sproul A., Wang W., Kukekov N., Greene LA. Apoptosis - Interactions involving proteins with a function related to apoptosis Radioactive proteins were visualized by SDS-PAGE/autoradiography zhxu@genetics.ac.cn Mouse brain. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology siah1_human E3 ubiquitin-protein ligase SIAH1 Seven in absentia homolog 1 Siah-1a SIAH1 HUMSIAH RING-type E3 ubiquitin transferase SIAH1 protein protein human Homo sapiens Human MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC sh3r1_mouse E3 ubiquitin-protein ligase SH3RF1 Posh1 Sh3rf1 Kiaa1494 Posh SH3 domain-containing RING finger protein 1 Plenty of SH3s SH3 multiple domains protein 2 Sh3md2 RING-type E3 ubiquitin transferase SH3RF1 protein protein mouse Mus musculus Mouse MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGVDELPSNILLVRLLDGIKQRPWKPGPGGGGGTTCTNTLRAQGSTVVNCGSKDLQSSQCGQQPRVQAWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVSGVHGFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEGMLADKIGIFPISYVEFNSAAKQLIEWDKPPVPGVDTAECPSATAQSTSASKHPDTKKNTRKRHSFTSLTMANKSSQGSQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHISTTGLIVTPPPSSPVTTGPAFTFPSDVPYQAALGSMNPPLPPPPLLAATVLASTPSGATAAVAAAAAAAAAAGMGPRPVMGSSEQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDGWYKGTSMHTSKIGVFPGNYVAPVTRAVTNASQAKVSMSTAGQASRGVTMVSPSTAGGPTQKPQGNGVAGNPSVVPTAVVSAAHIQTSPQAKVLLHMSGQMTVNQARNAVRTVAAHSQERPTAAVTPIQVQNAACLGPASVGLPHHSLASQPLPPMAGPAAHGAAVSISRTNAPMACAAGASLASPNMTSAMLETEPSGRTVTILPGLPTSPESAASACGNSSAGKPDKDSKKEKKGLLKLLSGASTKRKPRVSPPASPTLDVELGAGEAPLQGAVGPELPLGGSHGRVGSCPTDGDGPVAAGTAALAQDAFHRKTSSLDSAVPIAPPPRQACSSLGPVMNEARPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI sia1a_mouse E3 ubiquitin-protein ligase SIAH1A Seven in absentia homolog 1a RING-type E3 ubiquitin transferase SIAH1A Siah1a protein protein mouse Mus musculus Mouse MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC sia1b_mouse E3 ubiquitin-protein ligase SIAH1B Siah1b Seven in absentia homolog 1b RING-type E3 ubiquitin transferase SIAH1B protein protein mouse Mus musculus Mouse MSRQAATALSTGTSKCPPSQRVPALTDTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAVEKVANSVLFPCKYSASGCEITLPHTKKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC siah2_mouse E3 ubiquitin-protein ligase SIAH2 Siah2 Seven in absentia homolog 2 RING-type E3 ubiquitin transferase SIAH2 protein protein mouse Mus musculus Mouse MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGADPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ siah1_rat E3 ubiquitin-protein ligase SIAH1 Siah1 Siah1a Seven in absentia homolog 1 Siah-1a RING-type E3 ubiquitin transferase SIAH1 protein protein rat Rattus norvegicus (Rat) Rat MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC sh3r1_rat E3 ubiquitin-protein ligase SH3RF1 Posh1 Sh3rf1 Posh Sh3md2 SH3 domain-containing RING finger protein 1 Plenty of SH3s SH3 multiple domains protein 2 RING-type E3 ubiquitin transferase SH3RF1 protein protein rat Rattus norvegicus (Rat) Rat MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGVDELPSNILLVRLLDGIKQRPWKPGPGGGGSTTCTNVLRAQGSTVVNCGSKDLQSPQCGQQPRVQAWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGVHGFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEGMLADKIGIFPISYVEFNSAAKQLIEWDKPPVPGVDTAECPSATAAQSSSASKHSDTKKNTRKRHSFTSLTMANKSSQASQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHISTTGLIVTPPPSSPVTTGPSFTFPTDVPYQAALGTMNPPLPPPPLLATTVLASTPSGATAAAVAAAAAAVAAGVGPRPAVGSTEQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDGWYKGTSMHTSKIGVFPGNYVAPVTRAVTNASQAKVPMSTAGQASRGVTMVSPSTAGGPAQKPQGNGVAGNPSVVPTAVVSAAHIQTSPQAKVLLHMTGQMTVNQARNAVRTVAAHNQERPTAAVTPIQVQNAACIGPASVGLPHHSLASQPLPPMVGPAAHIAAVNINRTSVPLACAAGASSLASPNMTTAALETEPSGRTVTILPGLPTSPESAASACGNSSAVKPDKDSKKEKKGLLKLLSGASTKRKPRVSPPASPTLDVELGSGEVPLQGAVGPELPLGGVHGRVGSCPTDGDGPVAAGTAALAQDAFHRKTSSLDSAVPIAPPPRQACSSLGPVMNEARPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI sh3md2-siah1-1 Interaction between murine POSH (Sh3md2) and human SIAH1 demonstrated by coimunoprecipitation 490954 N/A 490958 unspecified role unspecified role bait bait Q8IUQ4:p.[Cys41Ser;Cys44Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 490959 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain false certain certain sequence position certain range range false physical association physical association false false false 1A RING finger domain of Sh3md2 deleted and shown not to be essential for interaction. Domain boundaries of deletion mutant not given, therefore estimated using ProSite domain boundaries. sh3md2-siah1-2 Interaction between murine POSH (Sh3md2) and human SIAH1 demonstrated by coimunoprecipitation 490954 N/A 490959 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain false certain certain sequence position certain range range false N/A 490958 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8IUQ4:p.[Cys41Ser;Cys44Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1B RING finger domain of Sh3md2 deleted and shown not to be essential for interaction. Domain boundaries of deletion mutant not given, therefore estimated using ProSite domain boundaries. sh3md2-siah1-3 Interaction between murine POSH (Sh3md2) and human SIAH1 demonstrated by coimunoprecipitation 490954 N/A 490958 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 490959 unspecified role unspecified role prey prey region delta ring sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain false certain certain sequence position certain range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C Exact amino acid residues removed from deltaRING construct of POSH (O70254) not given in entry, so taken from ProSite pattern PS00518. sh3md2-siah1-7 Interaction between murine POSH (Sh3md2) and human SIAH1 demonstrated by coimunoprecipitation 490954 N/A 490958 unspecified role unspecified role prey prey c-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 490959 unspecified role unspecified role bait bait region delta ring sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain false certain certain sequence position certain range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C Exact amino acid residues removed from deltaRING construct of POSH (O70254) not given in entry, so taken from ProSite pattern PS00518. sh3md2-siah1a-1 Interaction between murine POSH (Sh3md2) and Siah1a demonstrated by yeast 2 hybrid 490955 N/A 490959 unspecified role unspecified role bait bait N/A 490960 unspecified role unspecified role prey prey physical association physical association false false false sh3md2-siah1b-2 Interaction between murine POSH (Sh3md2) and Siah1b demonstrated by yeast 2 hybrid 490955 N/A 490961 unspecified role unspecified role prey prey N/A 490959 unspecified role unspecified role bait bait physical association physical association false false false sh3md2-siah2-1 Interaction between murine POSH (Sh3md2) and Siah2 demonstrated by yeast 2 hybrid 490955 N/A 490962 unspecified role unspecified role prey prey N/A 490959 unspecified role unspecified role bait bait physical association physical association false false false sh3md2-siah1-5 Interaction between rat POSH (Sh3md2) and SIAH1 demonstrated by coimunoprecipitation 490956 N/A 490963 unspecified role unspecified role bait bait N/A 490964 unspecified role unspecified role prey prey physical association physical association false false false 1E Camptothecin - a pro-apoptotic signal sh3md2-siah1-6 Interaction between rat POSH (Sh3md2) and SIAH1 demonstrated by coimunoprecipitation 490956 N/A 490963 unspecified role unspecified role prey prey N/A 490964 unspecified role unspecified role bait bait physical association physical association false false false 1E Camptothecin - a pro-apoptotic signal sh3md2-siah1-4 Interaction between murine POSH (Sh3md2) and human SIAH1 demonstrated by GST pull-down 490957 N/A 490958 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 490959 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1D