IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hershey-1999-1 The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. in vitro In vitro footprinting footprinting predetermined predetermined participant predetermined Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation hershey-1999-2 The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation hershey-1999-3 The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation hershey-1999-4 The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation hershey-1999-5 The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation if4e_yeast Eukaryotic translation initiation factor 4E CDC33 mRNA cap-binding protein eIF-4F 25 kDa subunit TIF45 YOL139C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGGKFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL 5B9162E1BD0B1BDE if4f1_yeast Eukaryotic initiation factor 4F subunit p150 YGR162W TIF4631 eIF4G1 mRNA cap-binding protein complex subunit p150 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDETAHPTQSASKQESAALKQTGDDQQESQQQRGYTNYNNGSNYTQKKPYNSNRPHQQRGGKFGPNRYNNRGNYNGGGSFRGGHMGANSSNVPWTGYYNNYPVYYQPQQMAAAGSAPANPIPVEEKSPVPTKIEITTKSGEHLDLKEQHKAKLQSQERSTVSPQPESKLKETSDSTSTSTPTPTPSTNDSKASSEENISEAEKTRRNFIEQVKLRKAALEKKRKEQLEGSSGNNNIPMKTTPENVEEKGSDKPEVTEKTKPAEEKSAEPEVKQETPAEEGEQGEKGQIKEESTPKVLTFAERLKLKKQQKEREEKTEGKENKEVPVQEETKSAIESAPVPPSEQVKEETEVAETEQSNIDESATTPAIPTKSDEAEAEVEAEAGDAGTKIGLEAEIETTTDETDDGTNTVSHILNVLKDATPIEDVFSFNYPEGIEGPDIKYKKEHVKYTYGPTFLLQFKDKLNVKADAEWVQSTASKIVIPPGMGRGNRSRDSGRFGNNSSRGHDFRNTSVRNMDDRANSRTSSKRRSKRMNDDRRSNRSYTSRRDRERGSYRNEEKREDDKPKEEVAPLVPSANRWVPKFKSKKTEKKLAPDGKTELLDKDEVERKMKSLLNKLTLEMFDAISSEILAIANISVWETNGETLKAVIEQIFLKACDEPHWSSMYAQLCGKVVKELNPDITDETNEGKTGPKLVLHYLVARCHAEFDKGWTDKLPTNEDGTPLEPEMMSEEYYAAASAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLTDSPSEETLESVVELLNTVGEQFETDSFRTGQATLEGSQLLDSLFGILDNIIQTAKISSRIKFKLIDIKELRHDKNWNSDKKDNGPKTIQQIHEEEERQRQLKNNSRSNSRRTNNSSNRHSFRRDAPPASKDSFITTRTYSQRNSQRAPPPKEEPAAPTSTATNMFSALMGESDDEE 391256802F86118E tif4631-tif45-1 Interaction of TIF4631 (eIF4G1) and TIF45 (eIF4E) by protease footprinting 370954 N/A 370959 unspecified role unspecified role neutral component neutral component N/A 370960 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 1 tif4631-tif45-2 Interaction of TIF4631 (eIF4G1) and TIF45 (eIF4E) by nmr 370955 N/A 370959 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 370960 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2 Only the nmr spectra of TIF4631 was measured. This was shown to be unstructured in the absence of TIF45 and folded in the presence of TIF45 which was taken by the suthor as experimental evidence of an interaction. tif4631-tif45-3 Interaction of TIF4631 (eIF4G1) and TIF45 (eIF4E) by coimmunoprecipitation 370956 N/A 370959 unspecified role unspecified role prey prey N/A 370960 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P39935:p.Glu425Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P39935:p.Lys444Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P39935:p.Leu457_Leu458delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5a tif4631-tif45-4 Interaction of TIF4631 (eIF4G1) and TIF45 (eIF4E) by coimmunoprecipitation 370957 N/A 370959 unspecified role unspecified role prey prey N/A 370960 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P39935:p.Glu425Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P39935:p.Leu457_Leu458delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 5b tif4631-tif45-5 Interaction of TIF4631 (eIF4G1) and TIF45 (eIF4E) by Far Western 370958 N/A 370960 unspecified role unspecified role prey prey P39935:p.Glu425Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P39935:p.Lys444Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P39935:p.Leu457_Leu458delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 370959 unspecified role unspecified role bait bait direct interaction direct interaction false false false 5c