IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hu-2009a-5 A class of dynamin-like GTPases involved in the generation of the tubular ER network. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 23 imex curation hu-2009a-6 A class of dynamin-like GTPases involved in the generation of the tubular ER network. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 23 imex curation hu-2009a-3 A class of dynamin-like GTPases involved in the generation of the tubular ER network. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 23 imex curation hu-2009a-4 A class of dynamin-like GTPases involved in the generation of the tubular ER network. rat-spinal-cord Rattus norvegicus spinal cord spinal-cord spinal cord anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 23 imex curation hu-2009a-1 A class of dynamin-like GTPases involved in the generation of the tubular ER network. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 23 imex curation hu-2009a-2 A class of dynamin-like GTPases involved in the generation of the tubular ER network. rat-spinal-cord Rattus norvegicus spinal cord spinal-cord spinal cord anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 23 imex curation hu-2009a-7 A class of dynamin-like GTPases involved in the generation of the tubular ER network. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 23 imex curation hu-2009a-8 A class of dynamin-like GTPases involved in the generation of the tubular ER network. in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 23 imex curation q9jk11-3 Reticulon-4 Nogo-C VP20 Rtn4 Nogo Foocen Glut4 vesicle 20 kDa protein Neurite outgrowth inhibitor protein protein rat Rattus norvegicus (Rat) Rat MDGQKKHWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAD atla1_human Atlastin-1 ATL1 GBP3 SPG3A Spastic paraplegia 3 protein A Guanine nucleotide-binding protein 3 GTP-binding protein 3 Brain-specific GTP-binding protein protein protein human Homo sapiens Human MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKKM reep5_mouse Receptor expression-enhancing protein 5 Reep5 Dp1 Polyposis locus protein 1 homolog Protein TB2 homolog GP106 protein protein mouse Mus musculus Mouse MRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWLPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLRHESQVDSVVKDVKDKAKETADAISKEVKKATVNLLGDVKKST q9nqc3-1 Reticulon-4 Nogo-A RTN-xL RTN4 KIAA0886 NOGO Foocen Neurite outgrowth inhibitor Neuroendocrine-specific protein Neuroendocrine-specific protein C homolog RTN-x Reticulon-5 My043 SP1507 RTN4A protein protein human Homo sapiens Human MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSVDETLFALPAASEPVIRSSAENMDLKEQPGNTISAGQEDFPSVLLETAASLPSLSPLSAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEVSEKAKTLLIDRDLTEFSELEYSEMGSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTALTKLVKEDEVVSSEKAKDSFNEKRVAVEAPMREEYADFKPFERVWEVKDSKEDSDMLAAGGKIESNLESKVDKKCFADSLEQTNHEKDSESSNDDTSFPSTPEGIKDRSGAYITCAPFNPAATESIATNIFPLLGDPTSENKTDEKKIEEKKAQIVTEKNTSTKTSNPFLVAAQDSETDYVTTDNLTKVTEEVVANMPEGLTPDLVQEACESELNEVTGTKIAYETKMDLVQTSEVMQESLYPAAQLCPSFEESEATPSPVLPDIVMEAPLNSAVPSAGASVIQPSSSPLEASSVNYESIKHEPENPPPYEEAMSVSLKKVSGIKEEIKEPENINAALQETEAPYISIACDLIKETKLSAEPAPDFSDYSEMAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMIEYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLSKKEKIPLQMEELSTAVYSNDDLFISKEAQIRETETFSDSSPIEIIDEFPTLISSKTDSFSKLAREYTDLEVSHKSEIANAPDGAGSLPCTELPHDLSLKNIQPKVEEKISFSDDFSKNGSATSKVLLLPPDVSALATQAEIESIVKPKVLVKEAEKKLPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE q9es97-3 Reticulon-3 Rtn3c Rtn3 B1 A1 protein protein mouse Mus musculus Mouse MAESSAATQSPSVSSSSSGAEPSALGGGGGSPGACPALGAKSCGSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE atla2_human Atlastin-2 ATL2 ARL6IP2 ADP-ribosylation factor-like protein 6-interacting protein 2 protein protein human Homo sapiens Human MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD yop1_yeast Protein YOP1 YOP1 YIP2 YPR028W YP9367.08 YIP1 partner protein 1 YPT-interacting protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH 6F1073444B653CCF sey1_yeast Protein SEY1 SEY1 YOR165W Synthetic enhancer of YOP1 protein O3590 protein protein yeast Saccharomyces cerevisiae Baker's yeast MADRPAIQLIDEEKEFHQSALQYFQQCIGNRDVGLDYHVISVFGSQSSGKSTLLNVLFNTNFDTMDAQVKRQQTTKGIWLAHTKQVNTTIEIDNDRPDIFVLDVEGSDGSERGEDQDFERKAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTVFEVNLSLFGKNDNDHKVLLLFVIRDHVGVTPLSSLSDSVTRELEKIWTELSKPAGCEGSSLYDYFDLKFVGLAHKLLQEDKFTQDVKKLGDSFVMKGTENYYFKPQYHHRLPLDGWTMYAENCWDQIERNKDLDLPTQQILVARFKTEEISNEALEEFISKYDESIAPLKGNLGSLTSQLVKLKEECLTKYDEQASRYARNVYMEKREALNTKLNSHISGTINEFLESLMEKLWDDLKLEVSSRDKATTSFVESVAAGKSKIEKEFNESMETFKKLGLLISNEEITCKFSDDIEERIKQLRDAELKAKIGRIKKNLVPELKDHVIHLLSHPSKKVWDDIMNDFESTIKDNISAYQVEKDKYDFKIGLSESENAKIYKNIRILAWRTLDTTVHDYLKIDTIVSILRDRFEDVFRYDAEGSPRLWKTEEEIDGAFRVAKEHALEVFEVLSLAVTSDNVEIIPDVPMAEEESGEDNEIYRDNEGVFHSRRFAHILTELQKENVLDQFRRQINITVLDSKRSIITTRTHIPPWIYVLLAVLGWNEFVAVIRNPLFVTLTLILGATFFVIHKFGLWGPVVNVVQSAVGETRTAIKDKLRQFVVEDHEVKESFEMKDFSKNEQKEK DEC0C9EC3AB172DF rtn1_yeast Reticulon-like protein 1 RTN1 YDR233C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSASAQHSQAQQQQQQKSCNCDLLLWRNPVQTGKYFGGSLLALLILKKVNLITFFLKVAYTILFTTGSIEFVSKLFLGQGLITKYGPKECPNIAGFIKPHIDEALKQLPVFQAHIRKTVFAQVPKHTFKTAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVAQGVEISKQKTQEFSQMACEKTKPYLDKVESKLGPISNLVKSKTAPVSSTAGPQTASTSKLAADVPLEPESKAYTSSAQVMPEVPQHEPSTTQEFNVDELSNELKKSTKNLQNELEKNNA 245575E65D3C2193 atla1_rat Atlastin-1 Atl1 Spg3a Spastic paraplegia 3A homolog protein protein rat Rattus norvegicus (Rat) Rat MAKSRRDRNSWGGFSEKSSDWSSEEEEPVRKAGPVQVLIVKDDHSFELDEAALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEDSVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYQQAFPAPKSEPTEQPEKKKI q9jk11-1 Reticulon-4 Nogo-A NI-220-250 Rtn4 Nogo Foocen Glut4 vesicle 20 kDa protein Neurite outgrowth inhibitor protein protein rat Rattus norvegicus (Rat) Rat MEDIDQSSLVSSSTDSPPRPPPAFKYQFVTEPEDEEDEEEEEDEEEDDEDLEELEVLERKPAAGLSAAAVPPAAAAPLLDFSSDSVPPAPRGPLPAAPPAAPERQPSWERSPAAPAPSLPPAAAVLPSKLPEDDEPPARPPPPPPAGASPLAEPAAPPSTPAAPKRRGSGSVDETLFALPAASEPVIPSSAEKIMDLMEQPGNTVSSGQEDFPSVLLETAASLPSLSPLSTVSFKEHGYLGNLSAVSSSEGTIEETLNEASKELPERATNPFVNRDLAEFSELEYSEMGSSFKGSPKGESAILVENTKEEVIVRSKDKEDLVCSAALHSPQESPVGKEDRVVSPEKTMDIFNEMQMSVVAPVREEYADFKPFEQAWEVKDTYEGSRDVLAARANVESKVDRKCLEDSLEQKSLGKDSEGRNEDASFPSTPEPVKDSSRAYITCASFTSATESTTANTFPLLEDHTSENKTDEKKIEERKAQIITEKTSPKTSNPFLVAVQDSEADYVTTDTLSKVTEAAVSNMPEGLTPDLVQEACESELNEATGTKIAYETKVDLVQTSEAIQESLYPTAQLCPSFEEAEATPSPVLPDIVMEAPLNSLLPSAGASVVQPSVSPLEAPPPVSYDSIKLEPENPPPYEEAMNVALKALGTKEGIKEPESFNAAVQETEAPYISIACDLIKETKLSTEPSPDFSNYSEIAKFEKSVPEHAELVEDSSPESEPVDLFSDDSIPEVPQTQEEAVMLMKESLTEVSETVAQHKEERLSASPQELGKPYLESFQPNLHSTKDAASNDIPTLTKKEKISLQMEEFNTAIYSNDDLLSSKEDKIKESETFSDSSPIEIIDEFPTFVSAKDDSPKLAKEYTDLEVSDKSEIANIQSGADSLPCLELPCDLSFKNIYPKDEVHVSDEFSENRSSVSKASISPSNVSALEPQTEMGSIVKSKSLTKEAEKKLPSDTEKEDRSLSAVLSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAD gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 spg3a-rtn4-7 Interaction between SPG3A (Atl1) and Rtn4 identified by coimmunoprecipitation 838418 n/a 838426 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838427 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A spg3a-rtn4-8 Interaction between SPG3A (Atl1) and Rtn4 identified by coimmunoprecipitation 838418 n/a 838426 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838427 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A spg3a-reep5-1 Interaction between SPG3A (Atl1) and Reep5 (DP1) identified by coimmunoprecipitation 838418 n/a 838428 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 838427 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A spg3a-reep5-2 Interaction between SPG3A (Atl1) and Reep5 (DP1) identified by coimmunoprecipitation 838418 n/a 838428 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 838427 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A spg3a-rtn4-9 Interaction between SPG3A (Atl1) and RTN4 identified by coimmunoprecipitation 838418 n/a 838429 unspecified role unspecified role prey prey reticulon region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false n/a 838427 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C Exact coordinates of the reticulon homology domain could not be traced so have been taken from the UniProtKB entry. spg3a-rtn4-10 Interaction between SPG3A (Atl1) and RTN4 identified by coimmunoprecipitation 838418 n/a 838429 unspecified role unspecified role bait bait reticulon region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false n/a 838427 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C Exact coordinates of the reticulon homology domain could not be traced so have been taken from the UniProtKB entry. spg3a-rtn3-1 Interaction between SPG3A (Atl1) and RTN3 identified by coimmunoprecipitation 838418 n/a 838430 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 838427 unspecified role unspecified role prey prey transmembrane region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2E, Supp. Fig. 2A Exact coordinates of the TM (transmembrane + C-terminal) domain could not be traced so have been taken from the UniProtKB entry. spg3a-rtn3-2 Interaction between SPG3A (Atl1) and RTN3 identified by coimmunoprecipitation 838418 n/a 838427 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838430 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp. Fig. 2A atl2-rtn3-1 Interaction between ATL2 and RTN3 identified by coimmunoprecipitation 838418 n/a 838430 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 838431 unspecified role unspecified role bait bait region Transmembrane + C-terminal domain sufficient to bind sufficient binding region sufficient to bind range range range range false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 3A and 4A Coordinates of the Transmembrane + C-terminal domain of Q8NHH9 not supplied in the paper so have been inferred from the UniProtKB entry. atl2-rtn3-2 Interaction between ATL2 and RTN3 identified by coimmunoprecipitation 838418 n/a 838430 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 838431 unspecified role unspecified role prey prey region Transmembrane + C-terminal domain sufficient to bind sufficient binding region sufficient to bind range range range range false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 3A and 4A Coordinates of the Transmembrane + C-terminal domain of Q8NHH9 not supplied in the paper so have been inferred from the UniProtKB entry. atl2-reep5-1 Interaction between ATL2 and Reep5 (DP1) identified by coimmunoprecipitation 838418 n/a 838431 unspecified role unspecified role prey prey region Transmembrane + C-terminal domain sufficient to bind sufficient binding region sufficient to bind range range range range false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838428 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 3B and 4B Coordinates of the Transmembrane + C-terminal domain of Q8NHH9 not supplied in the paper so have been inferred from the UniProtKB entry. atl2-reep5-2 Interaction between ATL2 and Reep5 (DP1) identified by coimmunoprecipitation 838418 n/a 838428 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838431 unspecified role unspecified role bait bait region Transmembrane + C-terminal domain sufficient to bind sufficient binding region sufficient to bind range range range range false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 3B and 4B Coordinates of the Transmembrane + C-terminal domain of Q8NHH9 not supplied in the paper so have been inferred from the UniProtKB entry. yop1-sey1-1 Interaction between YOP1 and SEY1 demonstrated by coimmunopreciptiation 838419 n/a 838432 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838433 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6D yop1-sey1-2 Interaction between YOP1 and SEY1 demonstrated by coimmunopreciptiation 838419 n/a 838432 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838433 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6D rtn1-sey1-1 Interaction between RTN1 and SEY1 demonstrated by coimmunopreciptiation 838419 n/a 838434 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838433 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6E rtn1-sey1-2 Interaction between RTN1 and SEY1 demonstrated by coimmunopreciptiation 838419 n/a 838433 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838434 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6E spg3a-rtn4-3 Interaction between SPG3A (Atl1) and Rtn4 identified by coimmunoprecipitation 838420 n/a 838435 unspecified role unspecified role bait bait n/a 838436 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B spg3a-rtn4-5 Interaction between SPG3A (Atl1) and Rtn4 identified by coimmunoprecipitation 838420 n/a 838436 unspecified role unspecified role bait bait n/a 838435 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1C spg3a-rtn4-4 Interaction between SPG3A (Atl1) and Rtn4 identified by coimmunoprecipitation 838421 n/a 838436 unspecified role unspecified role prey prey n/a 838435 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1B spg3a-rtn4-6 Interaction between SPG3A (Atl1) and Rtn4 identified by coimmunoprecipitation 838421 n/a 838436 unspecified role unspecified role bait bait n/a 838435 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1C spg3a-rtn4-1 Interaction between SPG3A (Atl1) and Rtn4 identified by coimmunoprecipitation 838422 n/a 838436 unspecified role unspecified role prey prey n/a 838435 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1A spg3a-rtn4-2 Interaction between SPG3A (Atl1) and Rtn4 identified by coimmunoprecipitation 838423 n/a 838436 unspecified role unspecified role prey prey n/a 838435 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1A spg3a-rtn3-3 Colocalisation of SPG3A (Atl1) and RTN3 838424 n/a 838427 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8WXF7:p.Lys80Ala GTP-binding mutant mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 838430 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp. Fig. 10 sey1-gtp GTPase activity of Sey1 838425 n/a 838437 enzyme target enzyme target substrate substrate neutral component neutral component n/a 838433 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q99287:p.Lys50Ala Alters kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction false false false Sup. Fig. 15